KEGG   Cupriavidus taiwanensis: RALTA_A2130Help
Entry
RALTA_A2130       CDS       T00702                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, hydrophobic subunit, cytochrome b556 with SdhC
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00020  Citrate cycle (TCA cycle)
cti00190  Oxidative phosphorylation
cti00650  Butanoate metabolism
cti01100  Metabolic pathways
cti01110  Biosynthesis of secondary metabolites
cti01120  Microbial metabolism in diverse environments
cti01130  Biosynthesis of antibiotics
cti01200  Carbon metabolism
Module
cti_M00009  Citrate cycle (TCA cycle, Krebs cycle)
cti_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
cti_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    RALTA_A2130 (sdhD)
   00650 Butanoate metabolism
    RALTA_A2130 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    RALTA_A2130 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C Fumarate_red_D GT87 CybS DUF3754
Motif
Other DBs
NCBI-ProteinID: CAQ70067
UniProt: B3R567
Position
1:complement(2253824..2254189)
Genome map
AA seq 121 aa AA seqDB search
MANNNIGPKRLVVGAHYGLKDWLAQRVTAVVMVVFTVILAIAFLLSNGASYEAWAGLFAN
QWMKIITFLTILSLLYHAWIGVRDIWMDYVKPMAVRLVLQVLTILWLVGCAGYAAQILWR
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
gtggcaaataacaatatcggtcccaagcgtcttgtcgtcggtgcgcactacggcctgaaa
gactggctcgcgcaacgcgtcaccgccgtggtcatggtggtcttcaccgtgatcctggcg
attgccttcctgctgtcgaacggcgcttcgtatgaagcgtgggcagggctcttcgccaac
cagtggatgaagatcatcacgttcctgaccatcctgtcgctgctgtatcacgcctggatc
ggcgtgcgcgatatctggatggactatgtgaagccgatggcggtgcgcctcgtgctgcaa
gttcttacgattctgtggctcgtcggttgcgcgggctacgctgctcagattctctggagg
gtgtaa

DBGET integrated database retrieval system