KEGG   Cupriavidus taiwanensis: RALTA_A2463Help
Entry
RALTA_A2463       CDS       T00702                                 

Gene name
holC
Definition
(GenBank) DNA POLYMERASE III, CHI SUBUNIT
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00230  Purine metabolism
cti00240  Pyrimidine metabolism
cti01100  Metabolic pathways
cti03030  DNA replication
cti03430  Mismatch repair
cti03440  Homologous recombination
Module
cti_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:cti00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    RALTA_A2463 (holC)
   00240 Pyrimidine metabolism
    RALTA_A2463 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    RALTA_A2463 (holC)
   03430 Mismatch repair
    RALTA_A2463 (holC)
   03440 Homologous recombination
    RALTA_A2463 (holC)
Enzymes [BR:cti01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     RALTA_A2463 (holC)
DNA replication proteins [BR:cti03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     RALTA_A2463 (holC)
DNA repair and recombination proteins [BR:cti03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     RALTA_A2463 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi STAS_2
Motif
Other DBs
NCBI-ProteinID: CAQ70396
UniProt: B3R662
Position
1:complement(2611203..2611637)
Genome map
AA seq 144 aa AA seqDB search
MTRIDFHSNVPDVLGYVCRLVRKAYGAGQKVVIHGAPAQLADLDARLWTFSALDFLPHCG
LESPNAAVTPILLAATTEGVPHHQLLINLAEEAPAQFASFERLIEVVGAGDAAREAGRQR
YRFYRERGYPLTHHDIGQPKGDAA
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgaatcgacttccacagcaacgtgccggacgtgctcggctatgtctgccggctg
gtccgcaaggcctacggcgccgggcagaaggtggtgatccacggtgcgccggcgcagctg
gcggacctggacgcgcgcctgtggaccttttccgcgctggacttcctgccgcattgcggc
ctggaaagccccaacgcggcggtcacgccgatcctgctggccgccaccaccgagggcgtg
ccgcaccaccagctgctgatcaacctggctgaagaagccccggcgcagtttgccagcttc
gagcggctgatcgaggtggtgggcgccggcgatgccgcgcgcgaggccggccggcagcgc
taccggttctaccgcgaacgcggctatccgctgacgcaccacgacatcggccagcccaag
ggagacgccgcatga

DBGET integrated database retrieval system