KEGG   Cupriavidus taiwanensis: RALTA_A2830
Entry
RALTA_A2830       CDS       T00702                                 

Gene name
xdhA1
Definition
(GenBank) xanthine dehydrogenase, molybdenum binding subunit
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00230  Purine metabolism
cti01100  Metabolic pathways
cti01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    RALTA_A2830 (xdhA1)
Enzymes [BR:cti01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     RALTA_A2830 (xdhA1)
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C RuvB_N Cadherin_5
Other DBs
NCBI-ProteinID: CAQ70756
UniProt: B3R756
Position
1:3000614..3002905
AA seq 763 aa
MMTHAVIGHSVKRTDLLDKVTGNAKYVADMPFPGLLYGKIKRSNVAHARIRRIDTSRALA
LPGVRAVLTHENVPRVLHAGSPHPRSASVTCDQYILDYKVRYWGEGVAAVAAVSEEIAER
ALELIEVEYETLPAVFTTEDAERSDAPRIHDREPGGNLVLPPVIVQRGDVEAGFAEADFI
LEGVYEGGRPTPAYMEPNVLTCSWDGNGNLTVWISTQTAFMVRGIMAEVLGLPLHKVRVL
VDHMGGGFGAKQDLFQHEFLCALLARETRRPVRMEYTREETFLGGRTRHPARIWLKQGFR
NDGTITARQARVVFNSGAYGSHGPGVTNVGTAALVSLYRCDNVLLEGRCVYTNSPIAGAF
RGYGVVQTYYALDVQMDEAAAHLGMDPAELKLRNAVREGDIAPSNHPLIGHGLEACIEKG
MALLDWPALRRRPRDTTGPVRTGWGLGCEMHGSSAYPGIKEQGNAIIKMNEDGTVVLLTG
AAGLGTGAHTALAQIIAEELTLPFEAVSVVHGDTDVVPWDIGAFASHTTYMVGKAAQMAA
GEIRRQLFERAAKLMECEPEALTLANGIIAVRDRDGPTLTVREAVMPRKGIPAAQLVGTA
TYHPTKSYSFAAHFVEVAVDTETGFITVRQVVPVHDVGKVIHPVAAAGQIEGGIQQGIGH
TLYEDYQIDMRTGRSLNANFVDYKMPLAMDMPEIRTVILEAAPDPGGPFGAKGVGEDPIV
AIGPAIANAVFDAIGVRFRHYPIKPEQVLQALAEKAAREGRQP
NT seq 2292 nt   +upstreamnt  +downstreamnt
atgatgacccacgccgtgatcggacacagcgtcaagcgcaccgacctgctcgacaaggtc
accggcaacgcgaaatacgttgccgacatgcccttccccggcctgctatacggcaagatc
aagcgcagcaacgtcgcccacgcccgcatccgccgcatcgacacctcgcgcgcgctggcg
ttgcccggggtcagggccgtgctgacgcacgagaacgtgccgcgcgtgctgcatgccggc
tcgccgcacccgagatccgcgtcggtgacctgcgaccagtacattctggactacaaggtg
cgctactggggcgagggtgtggccgcggtggcggcggtcagcgaagagatcgccgagcgc
gcgctcgagctgatcgaggtcgaatatgaaacgctgcccgcggtcttcaccaccgaagac
gcggagcgctccgacgcgccgcgcatccatgaccgagagcccggcggcaacctggtgctg
ccgcccgtgatcgtgcagcgtggcgacgtggaggccggctttgccgaagccgacttcatc
ctcgaaggcgtctacgagggcggccgtcccacccccgcgtacatggagcccaacgtgctc
acgtgcagctgggacggcaacggcaacctgacggtgtggatctccacccagaccgccttc
atggtgcgcggcatcatggccgaggtgctgggactgccgctgcacaaggtgcgcgtgctg
gtcgaccacatgggcggcggcttcggcgccaagcaggacctgttccagcatgagttcctg
tgcgcgctgctggcgcgcgagacgcgccggccggtgcgcatggagtacacgcgcgaggag
accttcctcggaggccgcacgcgccacccggccaggatctggctgaagcagggcttccgc
aacgacggcaccatcaccgcgcgccaggccagggtggtgttcaactccggcgcctacggc
tcgcacggccccggcgtgaccaacgtcggcaccgccgcgctggtgtcgctgtaccgctgc
gacaacgtgctgctcgaaggccgctgcgtctacaccaacagccccatcgccggcgctttc
cgtggctatggcgtggtgcagacctactacgcgctcgacgtgcagatggacgaggccgcc
gcgcacctgggcatggaccccgccgaactcaagctcaggaacgccgtgcgcgaaggcgat
atcgcgccgtcgaaccatccgctgatcggacacggcctcgaggcctgcatcgaaaagggc
atggcactgctcgactggcccgcgctgcgccgccgcccccgcgacaccaccggcccggtc
cgcaccggctggggcctggggtgcgagatgcacggcagcagcgcctatcccggcatcaag
gaacagggcaacgccatcatcaagatgaacgaggacggcaccgtggtactgctgaccggc
gcggccgggctggggaccggtgcgcataccgcgctcgcgcagatcatcgcggaagaactg
accttgccattcgaagcggtatcggtcgtgcacggcgacaccgacgtggtcccctgggac
atcggcgcctttgccagccacaccacctacatggtcggcaaggccgcgcagatggcggcc
ggcgagatcaggcgccagctgttcgagcgcgccgcgaagctgatggagtgcgagcccgaa
gccctgacgctggccaacggcatcatcgccgtgcgcgaccgcgacggccccacgctgacg
gtgcgcgaggcggtgatgccgcgcaagggcattcccgccgcgcagctggtgggcaccgcc
acctatcacccgaccaagtcgtattcgttcgcggcgcattttgtcgaagtcgcggtcgat
accgagaccggcttcatcaccgtgcggcaggtggtgccggtgcacgacgtcggcaaggtg
atccacccggtggcggcggcgggccagatcgaaggcggcatccagcaaggcatcggccac
acgctgtacgaggactaccagatcgacatgcgcaccggccgctcgctcaacgccaacttc
gtcgactacaagatgccgctggcaatggatatgccggagatccgcaccgtgatcctcgaa
gccgcgccggatcccggtggcccgttcggtgccaagggcgtgggcgaagacccgatcgtc
gcgatcgggccggcgatcgccaacgcggtgttcgatgccatcggcgtgcgcttccgccac
taccccatcaagccggagcaggtgctgcaggcgcttgccgaaaaggcggcgcgggaaggc
aggcaaccatga

DBGET integrated database retrieval system