KEGG   Cupriavidus taiwanensis: RALTA_B0404Help
Entry
RALTA_B0404       CDS       T00702                                 

Gene name
mhpC
Definition
(GenBank) 2-hydroxy-6-ketonone-2,4-dienedioic acid hydrolase
  KO
K16050  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase [EC:3.7.1.17]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00984  Steroid degradation
cti01100  Metabolic pathways
cti01120  Microbial metabolism in diverse environments
cti01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    RALTA_B0404 (mhpC)
Enzymes [BR:cti01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.17  4,5:9,10-diseco-3-hydroxy-5,9,17-trioxoandrosta-1(10),2-diene-4-oate hydrolase
     RALTA_B0404 (mhpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Esterase Abhydrolase_3 DUF1057 Ndr Abhydrolase_5 Lipase_3 BAAT_C
Motif
Other DBs
NCBI-ProteinID: CAP63599
UniProt: B2AIK0
Position
2:448549..449451
Genome map
AA seq 300 aa AA seqDB search
MSATSQHTPSTPPSTSAKPASLHPNLPVGRFVTTARGLRLHCLDTGAGEPVVFIHGSGPG
ASGHSNFRHNVPAFAAAGFRTVVVDLPGYGLSSKPDDVEYTLDFFVAALREQLLALELPR
CVLVGNSLGGAIALQYALDYPEHVSRLVMMAPGGVEERETYFEMPGIQRMVSLFTGGHMN
PDTMRQLLQLLVHDAGLVTDALVDERMAVCREQPREVLATMKVPNLTARLGEIRCPVLGF
WGTEDQFNPASGAAKFLSGCADARFVMINRCGHWVMVEHAAYFNRECLGFLADTAPRGAA
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtccgctacctcgcagcacacgccctcgacacccccgtccacgtcggccaagccggct
tcgctccaccccaacctgccggtggggcgcttcgtcaccaccgccagggggctgcgcctg
cactgcctggacaccggcgccggcgagccggtggtctttatccacggcagcgggccgggc
gcgagcgggcacagcaacttccgccacaacgtgccggcattcgccgccgcgggcttccgc
accgtggtggtggatctgcctggctacgggctgtcgtccaagccggacgatgtcgaatac
acgctggacttcttcgtcgccgcgctgcgcgaacagctgctggcgctggaactgccgcgc
tgcgtgctggtgggcaattcgctgggcggtgccatcgcgctgcaatacgcgctggattac
cccgagcatgtcagccgcctggtgatgatggcgcccggcggcgtggaagagcgcgagacc
tatttcgaaatgccggggatccagcgcatggtgtcgctgttcaccggcggccacatgaat
cccgacaccatgcgccagctgctgcaattgctggtgcacgacgccggcctggtcaccgac
gcgctggtcgacgagcgcatggcggtgtgccgcgagcagccgcgcgaagtgctggccacc
atgaaggtgcccaacctgaccgcgcggctgggcgagatccgctgcccggtgctgggcttc
tggggtaccgaggatcagttcaatcccgcctcgggggcggcgaagttcctgagcggctgc
gccgatgcgcgctttgtcatgatcaaccgctgcggccactgggtgatggtcgagcatgcg
gcgtacttcaaccgcgaatgcctgggcttcctggccgataccgccccgcgcggcgcggca
taa

DBGET integrated database retrieval system