KEGG   Cupriavidus taiwanensis: RALTA_B1008
Entry
RALTA_B1008       CDS       T00702                                 

Definition
(GenBank) conserved hypothetical protein; VGR-RELATED PROTEIN
  KO
K11904  type VI secretion system secreted protein VgrG
Organism
cti  Cupriavidus taiwanensis
Pathway
cti03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:cti00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    RALTA_B1008
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cti02044]
    RALTA_B1008
Secretion system [BR:cti02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RALTA_B1008
SSDB
Motif
Pfam: Phage_GPD DUF2345 T6SS_Vgr Phage_base_V Sarcoglycan_1
Other DBs
NCBI-ProteinID: CAQ71617
UniProt: B3R9P2
Position
2:complement(1050243..1053053)
AA seq 936 aa
MKPLSSYPSSAMAALSGLLGQRTRQITLETALTADDLVVERFVAQESVSTPFQLHIDCLS
PSAHLDTARLATEEITLRLMLADGSRRAWHGYVQTCAAIGGDGGLARYRLTVGTWFDHLR
ARTDCYVYQDKTALEIIEDVLADYPLAQYRMAVSQPLRKRSVCCQYRETDLDFVTRLLAE
EGLSYRFEHQQDGAEQSSREDKAQSRHCLVIFDNQAERPACAQPSIRFHRSDATEHEDAI
DHWSLQAATGTNAVTVASWDYKSLAATAADAGNESLGEWPALESFETRGTYRFPDADAAR
RAAQLRAQAHESCYLRYEGEGSVRALGAGERFTLTGHFDTAANEFVTLAVRHEAANNLGA
EVALLLGMSDIEAGSYRNRFEAVRADAPIVPVYSPKPTAPEGQPAVVIAEGGAPLTTERD
HRVRVRLPWLRAPMADPRADTAADPAQDDLSQVTAWVRVATAAAGPNWGVHHLPRAGTEV
MLTYLDGDIDRPMVVAQLHNEQDTLPWPATEAPLNTALSGWHSHNLGDGGYNQWIVDDNT
GQLRMRLASSAADTQLNLGYVIAQPPASGERGAWRGTGAELRTDAWAIVRAGNGLLLSTT
VQARAAGTMLDIREARGQITAAERTAQRLSDAATSQQALPLGALAAFEPLTKAIDPQQDG
SYPDRVNEQDARRPDTGTAAERFGQPWLVAESPSSIALATQATTSIFAGRHLLGLAQADW
HVGADNTVAAAAAKGVSLFSQNNGIRAIAAGGPVSIQAHTDALAVMADKAVTVTSSTDGI
EVLAQKKVVLHGGSSRIVLDGNAITFETPGLLSVKGAGHPLVGGGGNAAALPALPIPASQ
PNWIEMSLLGYEGQPMRNIEYELTFADGTKRTGKLNGVAEQREEAVPWGQATLTYKNNPA
AKDVPRPSLDDLLAATEPLIREEEARLNQDQTNTTA
NT seq 2811 nt   +upstreamnt  +downstreamnt
atgaagcccttgtcctcttacccgtcatccgcgatggctgccctgtccgggctgctgggc
caacgcacgcgccagatcacgctggagacggcgcttaccgccgacgacctggtagtggag
cgcttcgtcgcgcaggagagtgtcagcacaccgttccagctgcacatcgattgcctgagc
ccgtctgcacacctggacaccgcgcgcctggccaccgaggaaatcacgctgcggctgatg
cttgccgacggcagccgccgcgcctggcacggctatgtgcaaacctgcgcggccatcggc
ggcgacggtggcctggcgcgctaccggctgacggtggggacctggttcgatcacctgcgc
gcgcgcaccgattgctatgtgtaccaggacaagaccgcgctggaaatcatcgaagacgtg
ctggctgactatccgttggcccaataccgcatggcggtgagccagccgctgcgcaagcgc
tcggtctgctgccagtatcgcgagaccgatcttgactttgtcacgcggctgctggcggaa
gaaggcctgtcttatcgcttcgagcatcaacaggacggcgccgaacaatccagccgggag
gacaaggcccagtcccgtcattgcctggtcatcttcgacaaccaggccgaacgccccgcc
tgcgcgcagcccagcatccgcttccatcgcagcgacgccactgagcacgaagacgccatc
gaccattggtcgctgcaggcagccactggcaccaacgccgtcaccgtggcctcatgggac
tacaagtccctggccgccaccgccgccgacgccggcaacgaaagcctgggtgaatggccc
gcgctggaatccttcgaaacgcgcggcacgtaccgcttccccgacgccgatgccgcccgc
cgcgccgcgcagctgcgcgcgcaagcgcatgaaagctgctacctgcgctacgagggcgaa
ggcagcgtccgcgccctgggcgccggcgaacgcttcacgctgaccgggcacttcgacacc
gccgcgaacgagttcgtcacgttggcggtgcgccatgaagcggccaacaacctgggggcc
gaggtcgcgttgctgctgggcatgtccgacatcgaggccggcagctaccgcaaccgcttc
gaagccgtgcgcgccgatgccccgatcgtgccggtgtactcgcccaagcccaccgctccg
gaaggacagcctgccgtcgtcatcgccgaaggcggcgccccgctgaccaccgagcgcgat
caccgcgtgcgcgtgcgcctgccctggctgcgcgcgccgatggccgatcccagggccgac
accgccgccgacccggcccaggacgacctgagccaggtcaccgcctgggtgcgcgtggcg
accgccgcagccggtcccaactggggcgtgcatcacctgccccgcgccggcactgaggtc
atgctgacctacctcgatggcgacatcgatcgcccgatggtcgtggcgcaactgcacaac
gaacaggacaccctgccctggcccgccaccgaggcgccgctgaacacagcgttgtccggc
tggcattcgcacaacctcggcgacggcggctacaaccagtggatcgtcgacgacaacacc
ggccagctgcgcatgcgcctggccagctcggccgccgacacccagctcaaccttggctac
gtgatcgcgcagcctcccgccagcggagaacgcggcgcctggcgtggcaccggcgccgaa
ctgcgcaccgacgcgtgggccatcgtgcgcgccggcaacggcttgctgctgtcgacaacg
gtccaggccagggccgccggcaccatgctcgacatccgcgaagcccgcggccagatcacc
gccgccgagcgtaccgcccagcgcctgtccgatgccgccacctcgcagcaggcgctgccg
ctgggagcgctcgccgcgttcgaaccgctgaccaaggccatcgacccgcagcaggacggc
agctatccggaccgcgtcaacgagcaggacgccaggcgcccggataccggcaccgctgcc
gagcgcttcgggcaaccgtggctcgtcgcggaatcgcccagctcgattgcactggccacg
caggccaccaccagcatctttgccggacgccacctgctgggactggcacaggccgactgg
catgtcggcgccgacaacaccgtcgccgcggccgcggccaagggcgtgagcctgttcagc
cagaacaacgggattcgcgccattgcggccggcggaccggtttccatccaggcgcatacc
gatgcgctggcagtgatggccgacaaagccgtgacggtgacctcatcgaccgacggcatc
gaggtgctggcgcagaagaaagtggtgctgcacggcggctcgtcgcggatcgtgctggat
gggaatgcgattacgtttgagacaccggggttgttgtcggtgaagggggctgggcatccg
ttggtggggggtggggggaatgccgcggcgttgccggcgttgccaattccagcaagtcag
cccaactggatcgagatgagcctgctgggctatgaaggtcagcctatgcgcaacatcgaa
tacgaactcacgtttgccgacggcaccaagcgtacgggcaagctgaatggcgttgccgag
cagcgggaagaagccgtgccatggggtcaagccacgctcacgtacaagaacaacccggct
gcaaaggacgtgccccggccctctctggatgacctgctggcggccactgaaccgctcatc
cgtgaagaggaagcacggctaaaccaggaccagacgaatacgaccgcatga

DBGET integrated database retrieval system