KEGG   Cupriavidus taiwanensis: RALTA_B1017
Entry
RALTA_B1017       CDS       T00702                                 

Definition
(GenBank) conserved hypothetical protein; DUF879
  KO
K11896  type VI secretion system protein ImpG
Organism
cti  Cupriavidus taiwanensis
Brite
KEGG Orthology (KO) [BR:cti00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cti02044]
    RALTA_B1017
Secretion system [BR:cti02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   RALTA_B1017
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: CAQ71626
UniProt: B3R9Q1
Position
2:1060152..1061990
AA seq 612 aa
MLPYYERELAFLRRYSRDFAERYPKIAARLAMSADGCDDPHVERMIESFAFLSARISKKL
DDEYPEFTEALLEVLYPHYLSPFPSCSIAHFDVAGMAAQLSAPVTVPRGTLLTTRPVRKV
ECRFRTAYDVTFLPLRVAAAGFERAVSAPSTVALPKGATGAISIELEYLGEQGGFDALGR
QAVRVYLDGEPSFVAALGDALFLHVAAAYVEERPGVWKRLQRVPLREVGFGADEALIDTP
ARSHPAYRLLSEHFGFAEKFNFFDLDLDPVQRALLPGSAVRRVTLHLVLTDVRSDSNTAR
LLEGLGAAHLRLHCTPVVNLFRQKADPIRIEHTATAYPVVADSRRAHGFEVYSIDQVQLV
RETAASHDVVEFRPFYSLHHGEDPGSAGHYWIARRNALVAERSPGFETEISIVDSDFDPA
SPRTETLSLSVTCTNRDLPALLAFGQPDGDLTMEGSSIARRISFLRKPTSSMRLSSGRSS
QWRLVSLLALNHLSLVQNGLATLKEMLRLHDLPRSAISARQIEGIVGLDYKPTTQWLAGK
PFATFVRGLEIQLTLDEDAFVGTGLHRFIRVMDHFFGLYVHLNSFVQLVAVSRRGGKELA
RCAPRSGESILV
NT seq 1839 nt   +upstreamnt  +downstreamnt
ttgctgccatattacgaacgcgaactggccttcctgcgccggtattcgcgcgactttgcc
gagcgctatcccaagattgcggcgcgcctggcaatgtcggccgatggctgcgacgacccc
cacgtcgagcggatgatcgaatcgttcgccttcctgtccgcacgcatcagcaagaagctc
gacgacgagtaccccgaattcaccgaagcgctgctggaggtgctgtacccgcactacctg
agcccgtttccgtcctgctcgattgcgcatttcgacgtggccggcatggccgcgcagttg
agcgcgccggtcacggtgccgcgcggcacgttgctgaccacgcgcccggtgcgcaaggtg
gagtgccgtttccgaacggcctatgacgtgaccttcctgccgttgcgggtcgctgccgcg
ggctttgagcgggcggtgtccgcgccgtcgacggtggccttgccgaagggagccacgggc
gccatctcgatcgaactggagtacctgggcgagcagggcggcttcgatgcactgggccgc
caggcggtgcgcgtctacctggatggcgagccgtcattcgttgcggccctgggcgacgcg
ctattcctgcacgtggccgcggcgtatgtggaagagcgccccggtgtgtggaagcgcctg
cagcgggtgccgctgcgcgaggtgggtttcggcgcggacgaggcgctgattgacaccccc
gcgcgctcgcatccggcataccgcctgctgagcgagcatttcggctttgccgagaaattc
aacttcttcgatctcgacctggacccggttcagcgggcgctgttgcccggcagcgccgtg
cgccgcgtgacgctgcacctggtactgacagacgtgcgcagcgacagcaacaccgcgcgc
ctgctcgaagggcttggcgctgctcacctgcgcctgcattgcacgccggtggtcaacctg
ttccggcaaaaggccgacccgatccgcatcgagcataccgccaccgcttatccggtggtg
gccgacagccgccgcgcacacggtttcgaggtttattcgatcgaccaggtgcaactggtg
cgcgaaaccgccgccagccacgacgtggtggagttccggccgttctactccctgcaccat
ggcgaagatccgggcagcgccggccactactggatcgcccgccgcaatgccctggtagcg
gaacgcagcccgggcttcgagaccgaaatctccatcgtcgattcggacttcgatcccgcc
agcccacgcacggaaacgctgagcctgagcgttacctgcaccaaccgcgacctgcccgcg
ctgctggcgttcggtcagcccgatggcgacttgaccatggagggcagctcgatcgctcgc
cgcatcagcttcctgcgcaagccgacgtcgtcgatgcggctgagcagcgggcgctcgtcg
cagtggcggctggtttcgctgctggcgctgaatcacctgtccctggtgcagaacggcctc
gccacgctcaaggaaatgctgcgcctgcatgacctgccgcgcagcgcgatttcggcgcgg
cagatcgaaggcatcgttggcctggactacaagcccaccacgcagtggctggctggcaag
ccgttcgccacctttgtgcgcgggctggagatccagctgacgctggacgaggatgccttc
gtcggcaccggcctgcatcgctttatccgggtcatggatcatttctttggcctctatgtc
cacctgaacagctttgtgcagctggtcgcggtatcgcgccgcggcggcaaggaactggca
agatgcgcaccccgcagcggcgaatcgatcctggtgtaa

DBGET integrated database retrieval system