KEGG   Cupriavidus taiwanensis: RALTA_B1027
Entry
RALTA_B1027       CDS       T00702                                 

Definition
(GenBank) putative outer membrane protein; OmpA/MotB domain
  KO
K03286  OmpA-OmpF porin, OOP family
Organism
cti  Cupriavidus taiwanensis
Brite
KEGG Orthology (KO) [BR:cti00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:cti02000]
    RALTA_B1027
Transporters [BR:cti02000]
 Other transporters
  Pores ion channels [TC:1]
   RALTA_B1027
SSDB
Motif
Pfam: OmpA BON
Other DBs
NCBI-ProteinID: CAQ71635
UniProt: B3R9R0
Position
2:complement(1075767..1076585)
AA seq 272 aa
MVGTRTPALAAGLLAALVMLPGHAAPGDPGTTATPAASAAAPSGRVVAGGAVPDEATKAS
VLARLRELYGSANVVDQIEVGNVVSPPNWSGNVQKILSPQIKQVSRGQLSIDGTQVSVHG
DVRNEAQRQQIASDMATGLGQSYTVKNGLRVPASEQNLLDQTLANRIIEFETGAATLTPK
GRAILDEMAAVLPRLSGRKIEIVGHTDNSGSRALNLTLSQARAETVKNYLIGKGGEPGML
TAVGVGPDQPVAPNDKEEGRAKNRRIEFRAGQ
NT seq 819 nt   +upstreamnt  +downstreamnt
gtggttggaacacgcacgcctgcactggctgcgggcctgctggccgcgctggtcatgctg
cccggccatgccgcgcccggcgatcccggcaccaccgccacgcctgccgcgtctgcagcg
gcaccttcaggccgcgtcgtcgcaggcggcgcggtccccgacgaagccaccaaggcaagt
gtgctggcgcgcctgcgtgagctgtatggcagcgccaacgtggtggaccagatcgaagtc
ggcaacgtggtctcgcccccgaactggtcgggcaatgtgcagaagatcctctcgccgcaa
atcaagcaggtcagccgcggccagctgagcatcgatggcacgcaggtatccgtgcacggc
gacgtgcgcaacgaggcccagcgccagcagatcgccagcgacatggccaccggcctgggc
cagagctatacggtgaagaacggcctgcgcgtgcccgcttccgaacagaacctgctggac
cagaccctggccaaccggatcatcgaattcgaaacaggcgccgccacgctgacgcccaag
ggccgcgccatcctcgatgaaatggccgcggtgctgccgcgcctgagcggacgcaagatc
gagattgtcggccacacggacaactccggcagccgcgcgctgaacctgacgctaagccag
gcacgcgccgagaccgtgaagaactacctgatcggcaaaggcggcgagcccggcatgctg
acggcagtgggggtgggaccggaccagcccgtggcaccgaatgacaaggaggaagggcgg
gcgaagaaccggaggatcgagttccgggcggggcagtag

DBGET integrated database retrieval system