KEGG   Cupriavidus taiwanensis: RALTA_B1654Help
Entry
RALTA_B1654       CDS       T00702                                 

Definition
(GenBank) putative aminotransferase, class V
  KO
K03430  2-aminoethylphosphonate-pyruvate transaminase [EC:2.6.1.37]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00440  Phosphonate and phosphinate metabolism
cti01100  Metabolic pathways
cti01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    RALTA_B1654
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:cti01007]
    RALTA_B1654
Enzymes [BR:cti01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.37  2-aminoethylphosphonate---pyruvate transaminase
     RALTA_B1654
Amino acid related enzymes [BR:cti01007]
 Aminotransferase (transaminase)
  Class V
   RALTA_B1654
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 UPF0020 CMV_1a
Motif
Other DBs
NCBI-ProteinID: CAQ72249
UniProt: B3RBH4
Position
2:1779541..1780674
Genome map
AA seq 377 aa AA seqDB search
MIRGNDPILLTPGPLTTSLATKQAMLRDWGSWDAAFNTITRSLCDDLVRIVHGEGTHVCV
PMQGSGTFSVEAAIANVVPRDGKVLVPQNGAYCQRILKICKVLGRASVELPIPEDQPASA
ALIEDALRRDPSITHVAQVHCETGAGVLNPLQDIALLCQRLGKGLIVDAMSSFGAIEIDA
RTMPFDALVAATGKCIEGVPGMGFVLVKKDVLEASQGNSHSLALDLHDQYVYMQKTTQWR
FTPPTHVVAAFRAALDQFLEEGGQPVRGARYRRNCDTLVKGMAALGFRTFLPTAVQAPII
VTFHAPADARYDFKTFYAKVRERGYILYPGKLTQVETFRVGCIGAIDDNEMRNVVTAIGE
VLREMGIEMQGRLAEAA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atgatccgcggcaatgacccgatccttctgacccccggccccctgaccacctcgctcgcc
accaagcaggccatgctgcgcgactggggctcgtgggacgccgccttcaacaccatcacc
cgcagcctgtgcgacgacctggtgcgcatcgtccacggcgaaggcacccatgtctgcgtg
ccgatgcagggcagcggcaccttctcggtcgaagccgccatcgccaacgtggtgccgcgc
gacggcaaggtgctggtgccgcagaacggcgcctactgccagcgcatcctgaagatctgc
aaggtgctcgggcgcgccagcgtggaactgccgatccctgaagaccagcccgccagcgcc
gcgctgatcgaagacgcgctgcggcgcgacccgtcgatcacgcatgtggcgcaggtgcat
tgcgagaccggcgcgggcgtgctcaacccgctgcaggacatcgccctgctgtgccagcgg
ctgggcaagggcctgatcgtcgacgccatgagctcgttcggcgcgatcgagatcgatgcc
cgcaccatgcccttcgacgcgctggttgcggccaccggcaaatgcatcgagggcgtgccc
ggcatgggcttcgtgctggtgaagaaggacgtgctggaagccagccagggcaacagccat
tcgctggcgctcgacctgcacgaccagtatgtgtacatgcagaagaccacgcagtggcgc
ttcaccccgcccacgcacgtggtggcggccttccgcgcggcgctggaccagttcctggaa
gaaggcggccagccggtgcgcggcgcgcgctatcgccgcaactgcgacacgctggtcaag
ggcatggcggcgctgggcttccgcaccttcctgcccacggcggtgcaggcgccgatcatc
gtcaccttccatgcgccggcggatgcgcgctatgacttcaagaccttctacgccaaggtg
cgcgagcgcggctacatcctgtacccgggcaagctgacccaggtggaaaccttccgcgtc
ggctgcatcggcgcgatcgacgacaacgagatgcgcaacgtggtgacggcgatcggcgaa
gtgctgagggagatggggatcgagatgcaggggcggctggcggaggcggcgtaa

DBGET integrated database retrieval system