KEGG   Cupriavidus taiwanensis: pRALTA_0220
Entry
pRALTA_0220       CDS       T00702                                 
Symbol
trbD
Name
(GenBank) type IV secretory pathway, conjugal transfert protein
  KO
K20529  type IV secretion system protein TrbD
Organism
cti  Cupriavidus taiwanensis
Pathway
cti02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cti00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    pRALTA_0220 (trbD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cti02044]
    pRALTA_0220 (trbD)
Secretion system [BR:cti02044]
 Type IV secretion system
  Trb secretion system protein
   pRALTA_0220 (trbD)
SSDB
Motif
Pfam: VirB3 DUF2484
Other DBs
NCBI-ProteinID: CAP63898
UniProt: B2AK71
Position
pRALTA:186584..186913
AA seq 109 aa
MRKHHVSIGLSMPRLIAGAVRGLAIANGTIVALLIYVTYRSGWEIPAAIFVSGLCNHALL
AWLTSRDPWWNQILNIYNMYGDLYESVPWHGKSHSVFRRPYGFDSDLPC
NT seq 330 nt   +upstreamnt  +downstreamnt
atgcgcaagcaccatgtgagcatcggcttgtcgatgccgcgcctgatcgccggcgcggta
cgcggactggccatcgccaacggcaccatcgtcgcgctgctgatctatgtcacttaccgc
agtggctgggagatcccggcggcgatattcgtcagcggtctttgcaaccacgcgctgctg
gcctggctgacaagccgggatccatggtggaaccagattctcaacatctacaacatgtac
ggcgacctgtacgagtccgtcccctggcacgggaaatctcactcggtctttcgccggcct
tacggctttgacagcgacctgccatgctga

DBGET integrated database retrieval system