KEGG   Cupriavidus taiwanensis: pRALTA_0222
Entry
pRALTA_0222       CDS       T00702                                 
Symbol
trbJ
Name
(GenBank) Type IV secretory pathway, entry exclusion protein A (putative protein precursor)
  KO
K20266  type IV secretion system protein TrbJ
Organism
cti  Cupriavidus taiwanensis
Pathway
cti02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:cti00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    pRALTA_0222 (trbJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:cti02044]
    pRALTA_0222 (trbJ)
Secretion system [BR:cti02044]
 Type IV secretion system
  Trb secretion system protein
   pRALTA_0222 (trbJ)
SSDB
Motif
Pfam: DUF2458 TsaD
Other DBs
NCBI-ProteinID: CAP63900
UniProt: B2AK73
Position
pRALTA:189379..190137
AA seq 252 aa
MKKWIANIAIATSVFGASSAHAALPVTDWVGLVQTTMTAMQSLKTEVYENTNIIYQYKMM
ANQLLQATGLDVAAITEQLDSIADDIGKYEIYGTTLKDLYGTVSDNADYLKKIHSMVVAS
GKTKEQWFEDQRNLFRNGDKTAKALFSLGEQIYKNTQSVAKRRQKIQSSIKLSPTAQAAA
QTTNQMLDVLASQNSDLLQLMSVRAQADADKEQQSVAKESQSAEAMRAITIAQDEELKQL
RARVFSRKLQAD
NT seq 759 nt   +upstreamnt  +downstreamnt
gtgaagaagtggatcgccaacatcgccatcgcaacctcggtcttcggggcttcgtctgcc
cacgctgccctgccggtcaccgattgggttggcctcgtgcaaaccaccatgacggcaatg
cagtcgctgaaaaccgaggtctacgagaataccaacatcatctatcagtacaagatgatg
gccaaccagcttctgcaggccacaggtctggatgtggccgccattacggagcaactggac
tccatcgccgatgacatcggtaagtacgagatctacggcaccacgctcaaggacctctac
ggcacggtttcggacaacgccgactacctgaagaagattcatagcatggtcgtcgcttcg
ggaaaaaccaaggagcaatggttcgaggaccagcgcaatctgtttaggaacggcgacaag
actgccaaggccctgttcagcctgggcgagcaaatctacaagaatacgcagtcagtggcg
aagcgccggcaaaagattcaatcgagcattaagctctcgccgaccgcgcaagccgcggcg
cagacgaccaaccagatgctggacgtgctcgccagccagaactcggatctgctgcagctc
atgagcgttcgcgctcaagccgacgcggacaaggaacaacagagcgtcgcgaaggaatcc
caaagcgccgaggccatgcgcgcgattacgatcgcgcaggatgaagaactcaagcagctg
cgcgcccgcgtgttctcccgcaagctgcaagctgactga

DBGET integrated database retrieval system