KEGG   Cupriavidus taiwanensis: pRALTA_0314
Entry
pRALTA_0314       CDS       T00702                                 

Definition
(GenBank) Putative protein-S-isoprenylcysteine methyltransferase (czcN homolog); putative membrane protein
  KO
K21310  methanethiol S-methyltransferase [EC:2.1.1.334]
Organism
cti  Cupriavidus taiwanensis
Pathway
cti00920  Sulfur metabolism
cti01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cti00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    pRALTA_0314
Enzymes [BR:cti01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.334  methanethiol S-methyltransferase
     pRALTA_0314
SSDB
Motif
Pfam: ICMT PEMT DUF1295 NnrU ERG4_ERG24 Glyco_transf_22 DUF2852
Other DBs
NCBI-ProteinID: CAP63976
UniProt: B2AKE9
Position
pRALTA:268407..269072
AA seq 221 aa
MTEHPQYGYGLWSLVIINSAVFIVFAFSFAKPKTSRDWRSFGAFSAFIVALFTEMYGIPL
TIYLMLPWLSARFPGIDFLSHDAGHLPEMLFGWQGNPHLGPFHIASNILIFGGFLMLSSA
WRVLYNAQQEGRLATTGLYAHIRHPQYVAFILVMAGFLLQWPTILILLMFPVLAWMYVRL
ARAEEQDVLEAFGQQYEAYRRRTPGFVPRIRFSQLFRAKPH
NT seq 666 nt   +upstreamnt  +downstreamnt
atgaccgagcatccgcaatacggctatgggctgtggtcgctggtgatcatcaattcggcg
gtattcatcgtcttcgccttcagcttcgccaagcccaagacatctcgtgactggcggtcc
tttggcgcgttctcggcgttcattgttgctctcttcaccgagatgtacgggatccccttg
acgatctacctcatgctgccgtggctctcggcgagattccctggcatcgatttcctgtcg
cacgacgcgggccatctgcctgagatgctgttcggctggcaaggcaatccgcacctgggg
ccattccatatcgccagcaatatccttatcttcggcggcttcctgatgttgtcatccgcc
tggcgtgttctatacaatgcgcagcaggaaggccgtctggcgacgacgggcctctacgcg
cacatcaggcatccgcagtatgttgcgttcattctcgtcatggccggcttcctcctgcaa
tggccgacgattcttatcttgttgatgttcccggttctcgcctggatgtatgttcgcttg
gccagagcggaggagcaagatgtgctggaagcattcggccagcagtatgaagcgtaccgc
aggcgaacgcctgggttcgttccacggattcgattcagccagttgtttcgcgccaagcct
cactga

DBGET integrated database retrieval system