KEGG   Chlamydia trachomatis B/Jali20/OT: JALI_2041Help
Entry
JALI_2041         CDS       T00960                                 

Gene name
hemL
Definition
(GenBank) glutamate-1-semialdehyde 2,1-aminomutase
  KO
K01845  glutamate-1-semialdehyde 2,1-aminomutase [EC:5.4.3.8]
Organism
ctj  Chlamydia trachomatis B/Jali20/OT
Pathway
ctj00860  Porphyrin and chlorophyll metabolism
ctj01100  Metabolic pathways
ctj01110  Biosynthesis of secondary metabolites
ctj01120  Microbial metabolism in diverse environments
Module
ctj_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ctj00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    JALI_2041 (hemL)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctj01007]
    JALI_2041 (hemL)
Enzymes [BR:ctj01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.3  Transferring amino groups
    5.4.3.8  glutamate-1-semialdehyde 2,1-aminomutase
     JALI_2041 (hemL)
Amino acid related enzymes [BR:ctj01007]
 Aminotransferase (transaminase)
  Class III
   JALI_2041 (hemL)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: CAX10658
Position
240602..241870
Genome map
AA seq 422 aa AA seqDB search
MSHLFSKACQYFPGGVNSPVRACRAVNITPPIVARASKEVFVDSLDKTFIDFCGSWGSLI
HGHSHPKICAAIRQGLERGSSYGLTSEQEILFAEEIFSYLGLETNYKIRFMSTGSEATMT
AVRLARGITGRPIIIKFLGCYHGHADTFLQEKPFSHTSLETLDLAHPLTLSLPFNDFPLF
QTVMNSLGHKVAGVIFEPVCANMGVILPVPGFIEGVIQTCQQTGSFSIMDEVVTGFRVAQ
GGAAALYHVKPDILVFGKILGGGLPASAVVTPKDIMDHLAPEGKIFQAGTLSGNPLAMIA
GKVSVNLCREQGFYTQLATIEQNFLSPIEHMIRTTGIPVTLVRYGSLFSFFFNPNRPNNL
ADAQLSDIEAFQKFYQSAFSKGVYLSPSPFEASFLSAAHSMESLDYAQTALIESLEQVFS
LV
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgtcccacctcttctctaaagcctgtcaatattttccaggaggagttaattcccctgtt
agagcgtgtcgagccgttaatatcactcctcctatagtagctcgtgcctctaaagaggtt
tttgtagattctctggataaaacgtttatagacttttgtggatcatggggatctcttatc
catggacatagtcaccctaagatttgtgcagctatccgacagggcttagaacgaggaagt
tcttatggcctcacgtccgaacaagaaattctctttgccgaagaaattttttcgtattta
ggattagagacaaactacaaaattcgcttcatgtccacgggatcggaagcaactatgact
gctgttcgacttgctagaggtatcacaggacgacctattatcattaagtttttaggatgc
taccacggtcatgcagatacttttcttcaagaaaaacccttttcccatacttcgctagaa
actttagacctcgctcatcctcttaccctctctctacccttcaatgatttccccttattt
caaactgttatgaatagcttggggcataaggtcgctggagtcatttttgagcctgtatgt
gcgaatatgggggtgattctccccgtccctggttttattgaaggagttatccaaacctgc
cagcagaccggatctttttccattatggatgaagtggttacgggattccgggtcgcacaa
ggtggagctgcggctttgtatcatgtgaaacctgatattcttgtttttgggaaaatttta
ggtggaggcttacctgcatcagcagttgttacacctaaagacattatggaccatctggca
cccgaaggaaaaatcttccaagctggaacactttcaggaaatcctttggccatgatcgca
gggaaagtatctgtcaacttatgtcgggaacaaggtttttacacacaactcgcaactatt
gagcaaaactttttatcccctattgaacacatgattcgaactacaggaatccctgttaca
ttggtgcgatatggaagcctcttttcctttttctttaacccaaataggcctaacaatctt
gcggatgcacaacttagcgatatcgaagcttttcaaaagttttatcaatctgctttctca
aaaggagtatatctgtctccttctccttttgaagccagctttttatccgcagctcactct
atggaaagtttagattacgcccaaactgcattgatagaaagcttggaacaagtcttttct
ttagtttag

DBGET integrated database retrieval system