KEGG   Chlamydia trachomatis RC-J(s)/122: CTRC122_02785Help
Entry
CTRC122_02785     CDS       T02770                                 

Gene name
rplV
Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ctjs  Chlamydia trachomatis RC-J(s)/122
Pathway
ctjs03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ctjs00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CTRC122_02785 (rplV)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ctjs03011]
    CTRC122_02785 (rplV)
Ribosome [BR:ctjs03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    CTRC122_02785 (rplV)
  Bacteria
    CTRC122_02785 (rplV)
  Archaea
    CTRC122_02785 (rplV)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AGS00467
Position
complement(596782..597117)
Genome map
AA seq 111 aa AA seqDB search
MFKATARYIRVQPRKARLAAGLMRNRSVIEAQQQLSFSQMKAGRCLKKVLDGAIANAESN
ENIKRENLCVLEVRVDVGPMFKRMKSKSRGGRAPILKRTSHLTVIVGERGQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcgacagcccgatacatacgggttcagccaagaaaggctcgtttagctgca
ggattgatgagaaaccgtagtgttattgaagctcaacagcaactcagcttttctcagatg
aaggctggaagatgccttaaaaaagtgttggatggcgctattgcaaatgcagagtccaat
gaaaatataaaacgtgaaaatctttgcgttctagaagttcgggttgatgtcggcccaatg
ttcaaaagaatgaagtctaagagtcgtgggggaagagccccgattttgaagcgcacgagt
catctaactgtgattgttggcgagagagggcagtag

DBGET integrated database retrieval system