KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0146Help
Entry
CTLon_0146        CDS       T00646                                 

Gene name
bioF
Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
ctl00780  Biotin metabolism
ctl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctl00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    CTLon_0146 (bioF)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctl01007]
    CTLon_0146 (bioF)
Enzymes [BR:ctl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     CTLon_0146 (bioF)
Amino acid related enzymes [BR:ctl01007]
 Aminotransferase (transaminase)
  Class II
   CTLon_0146 (bioF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAP06544
Position
191214..192347
Genome map
AA seq 377 aa AA seqDB search
MKEALSIDFITNDFLGFSRLDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDG
VEHQIAHFHGAPEALILPSGFVANTAICAHLSSVADYVLWDEQVHISVSYNLSVFLSGWH
QSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSFAPLEQIVALSHQYHAQLIVD
EAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSCDRKQDLIKEPMVSL
STGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQ
ELYQKLVATGIRVGVACPPTGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGST
STMQRTLEDNFAAANAS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaagctctttctattgattttatcactaatgatttcctgggattctctcgttta
gatagcttagttcatgctgttgaggctcgttatcggctttattgtagagacaagcctcat
gcgcagttaggttatggaggttcgcgcgctattttaggctcttcctcgctgttagatggg
gtagagcatcaaatagcgcactttcatggcgctccagaagctcttattttgccaagtggt
tttgttgcgaatactgcgatttgtgcgcatctatcttccgtagcggattatgtgctatgg
gacgagcaggtgcatatctccgtttcttacaatctatctgtttttttgtcggggtggcat
cagagtttccgccataatgatctggatcatctagagtctttattagaatcttgtcagcaa
cgtggttttcaacgagtatttatcctcgtctgttctgtctattcttttaaggggtctttt
gctcctttggagcaaatagtggcattgtctcatcagtatcacgctcagttgatagttgat
gaagcgcatgctgtgggattatttggagacgctgggaagggattttgtgcctcgttaggg
tatgaaaatttttattctgtactcgttaccttcagtaaagctttgggatccgcgggtgca
gcttggttatcttcttgcgataggaagcaggatttgatcaaagaacctatggtaagtctt
tctacaggaatacctccctatttgttagtatctatacaagttgcatacgaatttctctca
caagaaggagaacttgcgagaacacgattacgtcgtattcgtgactattttgctcaaaaa
atctcttgggcagcagctggatttgtgcaaccgctctctctccctgggatctctgagcag
gaattgtatcaaaaattagttgccacaggcattcgtgttggagtcgcttgtcctcctaca
ggtaaagtactgcgagccaatttacatgctttcaataccgaacaagaagtagatattttg
gtttcgttgcttgccacggagcaagtaacgtatcagaagaatgtcgtaacaggatctaca
tcaacaatgcaacgcactttagaggacaattttgcagcggctaatgcctcttga

DBGET integrated database retrieval system