KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0799
Entry
CTLon_0799        CDS       T00646                                 

Gene name
aspS
Definition
(GenBank) aspartyl-tRNA synthetase
  KO
K01876  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
ctl00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:ctl00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CTLon_0799 (aspS)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctl01007]
    CTLon_0799 (aspS)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ctl03016]
    CTLon_0799 (aspS)
   03029 Mitochondrial biogenesis [BR:ctl03029]
    CTLon_0799 (aspS)
Enzymes [BR:ctl01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     CTLon_0799 (aspS)
Amino acid related enzymes [BR:ctl01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   CTLon_0799 (aspS)
Transfer RNA biogenesis [BR:ctl03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CTLon_0799 (aspS)
 Prokaryotic type
   Other AARSs
    CTLon_0799 (aspS)
Mitochondrial biogenesis [BR:ctl03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CTLon_0799 (aspS)
SSDB
Motif
Pfam: tRNA-synt_2 GAD tRNA_anti-codon tRNA-synt_2d tRNA-synt_2b Prok_Ub
Other DBs
NCBI-ProteinID: CAP07196
UniProt: B0B9Z5
Position
complement(926325..928073)
AA seq 582 aa
MKYRTHKCNELSLDHVGEHVRLSGWVHRYRNHGGVVFIDLRDRFGITQIVCRQEENPELH
QLMDQVRSEWVLCVEGLVCARLEGMENPNLVTGSIEVEVSSLEVLSRAQNLPFSISDEHI
NVNEELRLTYRYLDMRRGDILDRLMCRHKVMLACRQYLDEQGFTEVVTPILGKSTPEGAR
DYLVPSRIYPGNFYALPQSPQLFKQILMVGGLDRYFQIATCFRDEDLRADRQPEFTQIDM
EMSFGGPEDLFPVVEELVTRLFAVKGIELKAPFLRMTYQEAKDSYGTDKPDLRFGLRLKN
CCEYARKFTFSIFLDQLAHGGTVKGFCVPGGADMSRKQLDIYTDFVKRYGSMGLVWIKKQ
DGGVSSNVAKFASEDVFQEMFEAFEAKDQDILLLIAAPEAVANQALDHLRRLIAKERQLY
DSTQYNFVWITDFPLFAKEEGELCPEHHPFTAPLDEDISLLDSDPFAVRSSSYDLVLNGY
EIASGSQRIHNPDLQNKIFALLKLSQESVKEKFGFFIDALSFGTPPHLGIALGLDRIMMV
LTGAETIREVIAFPKTQKAGDLMMSAPSEILPIQLKELGLKL
NT seq 1749 nt   +upstreamnt  +downstreamnt
atgaagtacagaacgcataaatgtaatgagttgtcccttgatcatgtgggggaacatgtt
cgtttgtctgggtgggtgcatcgttaccgtaaccatgggggagttgttttcattgatttg
cgagatcgctttgggattactcagatagtgtgtcggcaagaggaaaacccagaacttcat
cagcttatggatcaagtccgttcagagtgggtgctttgtgtggaaggacttgtttgtgct
cggttagaggggatggagaacccgaatttggttacaggttctattgaggtagaggtttct
tccttggaagtgttgtctcgggcacagaatcttcctttttccatttctgatgaacacatt
aatgtaaacgaagaactgcggttaacttatcgctatttagatatgcgccgtggcgatatt
ttggacagattaatgtgccgacataaagttatgttagcttgcagacagtatttggatgaa
caaggttttacagaggtagttacgcctatcttaggaaaatctactccggaaggagcaaga
gactacttagtcccttcccgtatctatccagggaatttttatgctcttccacagtctcca
cagttgtttaaacaaattttgatggttggaggtttggatcggtatttccaaatagcgacc
tgtttccgtgatgaagatttgcgtgcggaccgtcaacctgagtttacacagatcgatatg
gaaatgagctttggtgggccagaggatctctttccagtggtagaagagcttgttacacgt
ttatttgctgtgaaagggattgaattaaaggcacctttcctgagaatgacgtatcaagaa
gctaaagactcctatggaacggacaaaccagatttacgtttcggcttgcgcctcaaaaat
tgttgtgaatatgcacgcaaattcacattctcgattttcttagatcaattagctcacggt
gggacagttaaaggattttgtgttccgggcggagcagatatgtctagaaagcagttagat
atctatacagatttcgttaagcgctatggatctatggggttagtatggattaaaaaacaa
gacgggggtgtatcgtctaatgttgccaaattcgcttcggaagacgtattccaagaaatg
tttgaagcttttgaggcaaaagaccaagatattttattgttaatagcagctccagaggct
gttgctaaccaggcattagatcatttgcgtaggttgattgcgaaagagcgtcaactttat
gattcaacgcaatataattttgtatggatcacggacttcccgctttttgctaaagaggaa
ggcgagttatgtccagagcatcatcctttcacagctccattagacgaggatatctcgctt
ttagactcagatccttttgctgttcgttcatcgagctatgatttggtgttaaatggttat
gaaattgcttctggttctcagcgtatacataatccagatttgcaaaataaaatatttgct
ttattaaagctgtcgcaagaaagtgtaaaagagaagttcgggttttttattgatgcgttg
agttttgggactcctccacatttagggattgctctgggattagatcgtattatgatggtt
ctaacaggagcggaaactattcgagaagtgattgcgttccctaaaacacagaaagcagga
gatttgatgatgtcggcaccttcagaaattttgccgattcaattaaaagaactggggttg
aaactataa

DBGET integrated database retrieval system