KEGG   Chlamydia trachomatis L2b/UCH-1/proctitis: CTLon_0863Help
Entry
CTLon_0863        CDS       T00646                                 

Definition
(GenBank) conserved hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
ctl  Chlamydia trachomatis L2b/UCH-1/proctitis
Pathway
ctl00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:ctl00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CTLon_0863
Enzymes [BR:ctl01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     CTLon_0863
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: CAP07260
UniProt: B0BA59
Position
1004084..1004713
Genome map
AA seq 209 aa AA seqDB search
MKILIASSHGYKVRETKAFLKKLGEFDIFSLVDYPSYQPPKETGETPEENAIQKGLFAAQ
TFRCWTIADDSMLIIPALGGLPGKLSASFAGEQANDKDHRKKLLENMRLLENTIDRSAYF
ECCVALISPFGKIFKAHASCEGTIAFEERGSSGFGYDPLFVKHDYKQTYAELPEAIKNQV
SHRAKALVKLQPYVETVLANHLLAGKESL
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcttatagccagttctcatggatataaggtgcgcgaaaccaaagcttttcta
aaaaaactaggagagtttgatatcttctcgcttgtagactacccatcctaccaaccccct
aaggaaactggcgaaaccccagaagaaaatgctattcagaaaggcttatttgcagctcaa
acctttcgttgttggactattgctgatgattctatgcttatcattccagctttaggtgga
ctcccaggaaaattatccgcttcttttgctggagaacaggcaaacgataaagatcatcgc
aaaaaacttcttgagaacatgcgtcttttagaaaatacaatcgatcgatcggcttatttt
gaatgctgcgtcgctttaatttctccttttggaaagatcttcaaagctcacgcctcttgc
gaaggaactattgcgtttgaggaacgcggttcctcagggtttggatatgatcctttgttt
gtaaaacatgactacaagcaaacttatgccgaattaccagaggcaattaaaaaccaagtt
tctcacagagcaaaagcattagtcaaattacagccctatgtggaaacggttctcgcaaat
cacttactcgcggggaaagagagtctctaa

DBGET integrated database retrieval system