KEGG   Chlamydia trachomatis L2b/Ams2: L2BAMS2_00223Help
Entry
L2BAMS2_00223     CDS       T02574                                 

Definition
(GenBank) aromatic acid decarboxylase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
ctla  Chlamydia trachomatis L2b/Ams2
Pathway
ctla00130  Ubiquinone and other terpenoid-quinone biosynthesis
ctla01100  Metabolic pathways
ctla01110  Biosynthesis of secondary metabolites
ctla01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ctla00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    L2BAMS2_00223
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    L2BAMS2_00223
Enzymes [BR:ctla01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     L2BAMS2_00223
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein Glyco_transf_4 DUF4072
Motif
Other DBs
NCBI-ProteinID: CCP90315
Position
245588..246166
Genome map
AA seq 192 aa AA seqDB search
MKRYVVGISGASGIVLAVTLVSELARLGHHIDVIISPSAQKTLYYELDTKSFLSTIPQNF
HNQIVLHHISSIESSVSSGSNTVDATIIVPCSVATVAAISCGLADNLLRRVADVALKEKR
PLILVPREAPLSAIHLENLLKLAQNGAVILPPMPIWYFKPQTAEDIANDIVGKILAILQL
DSPLIKRWENPR
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgaagcgctacgtggtgggtatttccggagcatctggtattgtattggcagtcacatta
gtttctgaacttgccagattaggacatcatattgatgtcatcatatcgccatccgcacaa
aaaactctttattatgagctagataccaagtcttttttatctacaatccctcaaaatttc
cataaccagattgttcttcaccatatatcctctatagaaagttctgtatcatcaggctcg
aatactgtagatgcaactattatagttccttgcagcgtagctactgttgcagcaatctca
tgtggtttggccgataatcttttaagaagagtcgctgatgttgctctgaaagaaaaaaga
cctctgattcttgtaccacgagaggctcctctatccgcaatacatttagaaaacttactc
aagctagcacagaatggagctgtaatactccctcctatgcctatttggtactttaaacct
cagactgcagaagatatagccaatgatattgtgggaaaaatcttagccattttacagcta
gatagtccccttataaaaagatgggagaacccccgctaa

DBGET integrated database retrieval system