KEGG   Chlamydia trachomatis L2b/Canada1: L2BCAN1_00550Help
Entry
L2BCAN1_00550     CDS       T02567                                 

Definition
(GenBank) 50S ribosomal protein L22
  KO
K02890  large subunit ribosomal protein L22
Organism
ctlc  Chlamydia trachomatis L2b/Canada1
Pathway
ctlc03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ctlc00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    L2BCAN1_00550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ctlc03011]
    L2BCAN1_00550
Ribosome [BR:ctlc03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    L2BCAN1_00550
  Bacteria
    L2BCAN1_00550
  Archaea
    L2BCAN1_00550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: CCP92409
Position
complement(589869..590204)
Genome map
AA seq 111 aa AA seqDB search
MFKATARYIRVQPRKARLAAGLMRNRSVVEAQQQLSFSQMKAGRCLKKVLDSAIANAESN
ENIKRENLCILEVRVDAGPMFKRMKSKSRGGRAPILKRTSHLTVIVGERGQ
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaagcgacagcccgatacatacgggttcagccaagaaaggctcgtttagctgca
ggattgatgagaaaccgtagtgttgttgaagctcaacagcaactcagcttttctcagatg
aaggctggaagatgccttaaaaaagtgttggatagcgctattgcaaatgcagagtccaat
gaaaatataaaacgtgaaaatctttgtattctagaagttcgggttgatgccggcccaatg
ttcaaaagaatgaagtctaagagtcgtgggggaagagccccaattttgaagcgcacgagt
catctaactgtgattgttggcgagagagggcagtag

DBGET integrated database retrieval system