KEGG   Chlamydia trachomatis L2b/Canada1: L2BCAN1_00791Help
Entry
L2BCAN1_00791     CDS       T02567                                 

Definition
(GenBank) protoporphyrinogen oxidase
  KO
K00231  protoporphyrinogen/coproporphyrinogen III oxidase [EC:1.3.3.4 1.3.3.15]
Organism
ctlc  Chlamydia trachomatis L2b/Canada1
Pathway
ctlc00860  Porphyrin and chlorophyll metabolism
ctlc01100  Metabolic pathways
ctlc01110  Biosynthesis of secondary metabolites
Module
ctlc_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:ctlc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    L2BCAN1_00791
Enzymes [BR:ctlc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     L2BCAN1_00791
    1.3.3.15  coproporphyrinogen III oxidase (coproporphyrin-forming)
     L2BCAN1_00791
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amino_oxidase NAD_binding_8 MCRA DAO Thi4 FAD_binding_3 FAD_binding_2 NAD_binding_9 Glyco_hydro_3
Motif
Other DBs
NCBI-ProteinID: CCP92636
Position
complement(862876..864150)
Genome map
AA seq 424 aa AA seqDB search
MKHALIVGSGIAGLSAAWWLHKRFPHVQLSILEKESRSGGLIVTEKQQGFSLNMGPKGFV
LAHDGQHTLHLIQSLGLADELLYSSPEAKNRFIHYNNKTRKVSPWTIFKQNLPLSFAKDF
FARPYKQDSSVEAFFKRHSSSKLRRNLLNPISIAIRAGHSHILSAQMAYPELTRREAQTG
SLLRSYLKDFPKEKRTGPYLATLRSGMGMLTQALHDKLPATWYFSAPVSKIRQLANGKIS
LSSPQGEITGDMLIYAGSVHDLPSCLEEIPETKLIKQTTSSWDLSCVSLGWHASLPIPHG
YGMLFADTPPLLGIVFNTEVFPQPERPNTIVSLLLEGRWHQEEAYAFSLAAISEYLQIYT
PPQAFSLFSPREGLPQHHVGFIQSRQRLLSKLPHNIKIVGQNFAGPGLNRATASAYKAIA
SLLP
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaaacatgctctcattgttggctcaggtattgccggcctttctgccgcgtggtggcta
cacaaacgattccctcatgtgcagttgtctattctagaaaaagagtctcgatctggaggg
ctaattgtcacagagaaacaacaagggttttccctcaatatgggccctaaaggttttgtt
ttagctcatgatgggcaacacacccttcacctcattcagtctttaggcctagcagacgag
ctattatatagctctccagaggctaaaaaccgctttatccactataataataaaacccga
aaagtctcgccttggactattttcaaacaaaatctccctctctcttttgctaaggatttc
tttgcgcgtccttacaaacaagacagctccgtggaagccttctttaaaagacacagttct
tccaagcttagaagaaatcttttaaatcccattagcattgctattcgtgcaggacatagt
catatattgtctgcacagatggcttacccagaattaacgcgaagagaagctcaaacagga
tcgttgttacgtagttatctcaaagattttcctaaagagaaacgcacaggcccttattta
gctaccttgcggtctgggatgggaatgctaacccaggctttgcatgataaattgcctgct
acctggtatttttctgcacccgtcagcaaaatccgtcagttggcgaacgggaaaatttct
ctttcatctcctcaaggagaaataacgggagatatgctcatttatgctgggtccgtgcac
gatctcccttcctgtctagaagagatccctgaaaccaagcttatcaagcaaacgacttca
tcttgggatctctcttgtgtatctttaggatggcatgcatccctccctatccctcatgga
tatggcatgcttttcgctgatacgcctcccttattagggatcgtgtttaatacggaagtg
ttccctcaacccgagcggcctaatacaatagtctctcttcttttagaaggtcgatggcac
caagaagaagcgtatgctttctcactagcagctatttctgagtacctgcaaatttacact
cctccccaagctttctcactattctctcctcgagagggacttccccaacaccatgttgga
tttatccaatcccgccaacgccttctatctaaacttcctcacaatataaaaattgtaggg
cagaattttgcaggtccaggtctcaaccgcgctacagcgtctgcttataaagctatagct
tctttactaccatga

DBGET integrated database retrieval system