KEGG   Chlamydia trachomatis L1/115: L1115_00807Help
Entry
L1115_00807       CDS       T02569                                 

Definition
(GenBank) UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase
  KO
K01925  UDP-N-acetylmuramoylalanine--D-glutamate ligase [EC:6.3.2.9]
Organism
ctlj  Chlamydia trachomatis L1/115
Pathway
ctlj00471  D-Glutamine and D-glutamate metabolism
ctlj00550  Peptidoglycan biosynthesis
ctlj01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctlj00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    L1115_00807
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    L1115_00807
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ctlj01011]
    L1115_00807
Enzymes [BR:ctlj01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.9  UDP-N-acetylmuramoyl-L-alanine---D-glutamate ligase
     L1115_00807
Peptidoglycan biosynthesis and degradation proteins [BR:ctlj01011]
 Precursor biosynthesis
  Amino acid ligase
   L1115_00807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C Pyr_redox_2 2-Hacid_dh_C TrkA_N 3HCDH_N DAO Oxidored_q6 UDPG_MGDP_dh_N NAD_Gly3P_dh_N Mur_ligase NAD_binding_2 AlaDh_PNT_C FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: CCP64584
Position
888102..889352
Genome map
AA seq 416 aa AA seqDB search
MGLERVVVIGLGVSGRSIARFLAQKGVCVLGVDKSLHALQNCPYIQEKYLENEEFPSQVD
YVVRSPGVSKEHPWVQAAIASHIPVMTDIQLAFQTEKFTERESLAITGTTGKTTTILFLE
YLFKRSGIPAFAMGNVGIPILDGMQNPGVRIVEISSFQLADQEKSYPVLSGGMILNISDN
HLDYHGNFSEYFQAKQNLALCMRNPDDLWVGDERFYGHLYLEEVQKYMRLLDKESALKPL
YLHDKYNYCCAYLLAKIEFPISETSFIEAVATFNKPPHRMEYLGQKQGIHYINDSKATTV
SATETALLGVGNQAIVILGGRNKGCTFSSLLPALRKAAKSVVAMGECAQEIARDLEEFPV
TVVKNLSEALLCAEEQAVPGDVIVLSPACASFDQFRSYEERGAMFKHLVGMEEVLL
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgggattggagcgtgttgtcgttatcggcctaggtgtctctgggaggtctattgcgcgt
tttctagctcaaaaaggtgtatgtgtattgggtgtagacaagtcgcttcatgcacttcag
aattgcccgtatattcaggaaaaatatttggagaacgaagagttcccttcacaggtggat
tatgttgttcgttctccaggagtatccaaggagcatccttgggtacaggctgcgatagcc
tcgcacattcctgtcatgacagatattcagttagcttttcaaacagaaaaatttacagaa
agagagtcgttagcaatcacagggactacaggtaagacaaccacaatattatttttagaa
tacttattcaaacggtctgggattcctgctttcgctatggggaatgtaggaattcctatt
ttagatggtatgcagaatcctggagtgcggattgttgaaatcagctctttccagctcgct
gatcaagaaaaatcctatcctgtcttatctggaggaatgattctaaatatctcagataac
catttagattatcatgggaatttctctgagtattttcaagccaagcaaaatcttgcttta
tgtatgcgtaatcccgatgacctttgggtaggagatgagcgtttttacggccacttgtat
ttagaagaagtacagaagtatatgcgtttattagataaagaaagtgcattaaaaccattg
tacttgcatgataagtacaactactgttgtgcctatctgcttgctaaaatagaattccca
atatccgaaactagctttatagaggctgtggctacttttaacaagcctcctcacaggatg
gaatatttggggcaaaagcaaggcatacattatatcaatgatagtaaggcaaccacggtg
agtgctacagaaacagctcttttaggggttgggaatcaggcaattgtgattctcggagga
agaaataagggatgcacgttctcttcgcttcttcccgctttgcgaaaagctgcgaagagt
gtagtcgctatgggagagtgcgctcaggagatcgctcgagatctagaagagttccctgta
accgtagtgaaaaatttatctgaggctttactatgtgctgaagagcaagcagtgcctgga
gatgtgattgtattgtctccggcttgtgctagctttgatcaattccgtagctatgaagag
cgaggggcaatgtttaagcatttggttgggatggaagaggttcttttatga

DBGET integrated database retrieval system