KEGG   Chlamydia trachomatis L2b/Ams4: L2BAMS4_00825Help
Entry
L2BAMS4_00825     CDS       T02576                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
ctls  Chlamydia trachomatis L2b/Ams4
Pathway
ctls00780  Biotin metabolism
ctls01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctls00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    L2BAMS4_00825
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctls01007]
    L2BAMS4_00825
Enzymes [BR:ctls01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     L2BAMS4_00825
Amino acid related enzymes [BR:ctls01007]
 Aminotransferase (transaminase)
  Class II
   L2BAMS4_00825
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CCP93561
Position
908400..909533
Genome map
AA seq 377 aa AA seqDB search
MKEALSIDFITNDFLGFSRLDSLVHAVEARYRLYCRDKPHAQLGYGGSRAILGSSSLLDG
VEHQIAHFHGAPEALILPSGFVANTAICAHLSSVADYVLWDEQVHISVSYNLSVFLSGWH
QSFRHNDLDHLESLLESCQQRGFQRVFILVCSVYSFKGSFAPLEQIVALSHQYHAQLIVD
EAHAVGLFGDAGKGFCASLGYENFYSVLVTFSKALGSAGAAWLSSCDRKQDLIKEPMVSL
STGIPPYLLVSIQVAYEFLSQEGELARTRLRRIRDYFAQKISWAAAGFVQPLSLPGISEQ
ELYQKLVATGIRVGVACPPTGKVLRANLHAFNTEQEVDILVSLLATEQVTYQKNVVTGST
STMQRTLEDNFAAANAS
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggaagctctttctattgattttatcactaatgatttcctgggattctctcgttta
gatagcttagttcatgctgttgaggctcgttatcggctttattgtagagacaagcctcat
gcgcagttaggttatggaggttcgcgcgctattttaggctcttcctcgctgttagatggg
gtagagcatcaaatagcgcactttcatggcgctccagaagctcttattttgccaagtggt
tttgttgcgaatactgcgatttgtgcgcatctatcttccgtagcggattatgtgctatgg
gacgagcaggtgcatatctccgtttcttacaatctatctgtttttttgtcggggtggcat
cagagtttccgccataatgatctggatcatctagagtctttattagaatcttgtcagcaa
cgtggttttcaacgagtatttatcctcgtctgttctgtctattcttttaaggggtctttt
gctcctttggagcaaatagtggcattgtctcatcagtatcacgctcagttgatagttgat
gaagcgcatgctgtgggattatttggagacgctgggaagggattttgtgcctcgttaggg
tatgaaaatttttattctgtactcgttaccttcagtaaagctttgggatccgcgggtgca
gcttggttatcttcttgcgataggaagcaggatttgatcaaagaacctatggtaagtctt
tctacaggaatacctccctatttgttagtatctatacaagttgcatacgaatttctctca
caagaaggagaacttgcgagaacacgattacgtcgtattcgtgactattttgctcaaaaa
atctcttgggcagcagctggatttgtgcaaccgctctctctccctgggatctctgagcag
gaattgtatcaaaaattagttgccacaggcattcgtgttggagtcgcttgtcctcctaca
ggtaaagtactgcgagccaatttacatgctttcaataccgaacaagaagtagatattttg
gtttcgttgcttgccacggagcaagtaacgtatcagaagaatgtcgtaacaggatctaca
tcaacaatgcaacgcactttagaggacaattttgcagcggctaatgcctcttga

DBGET integrated database retrieval system