KEGG   Chlamydia trachomatis L1/224: L1224_00846Help
Entry
L1224_00846       CDS       T02570                                 

Definition
(GenBank) phosphatidylglycerophosphate synthetase
  KO
K00995  CDP-diacylglycerol---glycerol-3-phosphate 3-phosphatidyltransferase [EC:2.7.8.5]
Organism
ctlx  Chlamydia trachomatis L1/224
Pathway
ctlx00564  Glycerophospholipid metabolism
ctlx01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctlx00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    L1224_00846
Enzymes [BR:ctlx01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.5  CDP-diacylglycerol---glycerol-3-phosphate 1-phosphatidyltransferase
     L1224_00846
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CDP-OH_P_transf DUF3966
Motif
Other DBs
NCBI-ProteinID: CCP65512
Position
931849..932397
Genome map
AA seq 182 aa AA seqDB search
MILYLKGRWFGLSAAFLPYVLLFLLIITEITDAVDGYIARKFSQVTDLGKLLDPMADSVY
RISLYLTFTQPPVNLPLILVFIFLARDSVISTLRTLCASRGQVLAARMSGKLKAILQAIS
FFFIIFSMFLCAKGIISTDDLEFFSTVIVSLVAFYSICSGVEYIWVNKSHLLQKNDSPDG
ES
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgattctttacttaaaaggtcggtggttcgggttgtctgccgcattcctgccttatgtt
ctcctctttttgctgatcattacggaaatcacggatgctgtagatggatatattgcgaga
aagttttcccaggtaacagatctgggaaaacttctagatcccatggctgatagtgtatac
cgtatttcgctgtacctcacgttcacacaaccccccgtgaatcttcctctcatacttgtg
tttattttcttagctcgagattccgttattagcactttgcgtacgctgtgcgctagtagg
ggacaagtattagctgctaggatgagtgggaagttaaaagctattcttcaagctattagc
ttctttttcatcattttctcgatgttcctttgtgcaaaaggcattatctccacagacgat
ttagagtttttctcaacagtgatagtgtctttagtagccttttattctatttgctctgga
gttgagtatatttgggtgaataaaagtcacttattacagaaaaatgactcgccggatggc
gagtcatag

DBGET integrated database retrieval system