KEGG   Chloracidobacterium thermophilum: Cabther_A0220Help
Entry
Cabther_A0220     CDS       T01629                                 

Definition
(GenBank) Phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
ctm  Chloracidobacterium thermophilum
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cabther_A0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AEP10992
UniProt: G2LHT2
Position
1:270036..271436
Genome map
AA seq 466 aa AA seqDB search
MDALFGEALPPTTLVLLLVSLAVAFGFEFVNGFHDTANAVATVIYTKSLRPWTAVVWSGI
CNFCGVFFGGIAVAMGIVYLLPVELLISKSTSAGLAMALALLLGAIIWNLGTWYFGLPAS
SSHTLIGAIVGVGLANSLLPGHRFGDGVNWGKVSETGLSLLISPLIGFSLAALLVLLSRW
LIPDKRLYEKPDEHNPPPLWIRAILILTCTGVSFAHGSNDGQKGIGLVMLILTGIVPASF
ALDMSFNAQQMESARQALVRMDGVASRLAPSEAEALQSAVARVRGALDGHTTLGEIPREQ
RKDLRSDIIKLDATVKKVLKAEPAALSAAEAGTLKQDAALLKSLTDYAPLWVKIAIALSL
GIGTMVGWKRIVITIGEKIGKEHLTYAQGASAELVAMSSIGMASYLGLPVSTTHVLSSGV
AGTMVAKGSGLQAATVIKIASAWVLTLPAAIGLAGGLFLLFHWLFV
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
atggatgcattatttggcgaggcgcttccgccgacgaccctcgtgctgctcctcgtgtcg
cttgccgtcgcttttggtttcgagttcgttaacggttttcacgacacagccaatgccgta
gccaccgtgatctacacgaagtcgctgcgtccctggacggctgtggtctggtccgggatt
tgcaacttctgcggcgtgtttttcggcgggattgccgtggccatgggcatcgtctatctg
ctgcccgtcgagctgctcatttcaaagagcaccagcgccgggctggccatggcgctcgcc
ctgctgctgggagccattatctggaatctgggcacgtggtacttcgggctgccggcttcc
agttcgcacacgctgattggtgcgattgtcggcgtcggtcttgccaattcgcttctgccc
ggtcatcgctttggtgatggggtcaactggggcaaggtctcggaaaccgggctgtcgttg
ctgatctcaccgctcatcggtttttcgctggcggccctgctcgtcctgctgtcaaggtgg
ctgattcccgacaagcggttgtacgaaaagccggatgagcacaatccgccgccgctgtgg
attcgcgccattctcatcctgacctgcaccggcgtgagtttcgcccacggctccaacgac
ggccagaagggcatcgggctggtgatgctcattctcacggggattgtcccggcttcgttt
gcgctggatatgtccttcaacgcccagcagatggaaagcgcccggcaggcgctcgtgcgc
atggatggcgttgcatcccggctggccccgtccgaggctgaggcacttcagtcggctgtc
gcgcgggtgcggggggcgcttgatggtcacaccacgctgggggagattccgcgtgagcaa
cgcaaagacctgcgctcggacatcatcaagctcgatgccacagtgaagaaagtcctcaag
gcggagccagccgccctttctgcggctgaagccggcaccctcaagcaggatgccgccctg
ctcaagtcactcaccgactatgctcccctgtgggtcaaaatcgccattgccctttcgctg
ggcattgggacgatggtcggctggaagcgcatcgtcatcaccattggcgaaaaaatcggc
aaagagcatctgacgtacgcacagggagcctcggctgagctggtggcgatgtccagcatc
gggatggcgtcctacctggggttgccggtgagtacaacgcacgtgttgtcgtcaggtgtc
gccggcacgatggtggccaaggggtcgggccttcaggcggccaccgtcatcaagattgcc
tcggcctgggtgctgacccttccggccgccatcgggctggccggcggactgtttctgttg
ttccactggctgttcgtctag

DBGET integrated database retrieval system