KEGG   Chloracidobacterium thermophilum: Cabther_A1044Help
Entry
Cabther_A1044     CDS       T01629                                 

Definition
(GenBank) Nitrogenase molybdenum-iron protein, alpha and beta chains
  KO
K04039  light-independent protochlorophyllide reductase subunit B [EC:1.3.7.7]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00860  Porphyrin and chlorophyll metabolism
ctm01100  Metabolic pathways
ctm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cabther_A1044
Enzymes [BR:ctm01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Cabther_A1044
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Oxidored_nitro PCP_red HNH_repeat
Motif
Other DBs
NCBI-ProteinID: AEP11798
UniProt: G2LH56
Position
1:complement(1234067..1235587)
Genome map
AA seq 506 aa AA seqDB search
MIDRQCGFPSVTNVSYGRKEVSTTGVDRMMTVVEQVERTHKPRVIQVIPTCTSNLLKEDV
GGALNRMQATCNAKLLFLQLNAFCEKEDQGADMTFAGLVEHLATGTGERTPEPTVNILGL
TSLGFRHRDDLREITQLLNQCGIRVNAALPLGGTAADFQRLGQAWFNVVPYAEIGLRAAR
VLENRFGQPYLVHAPIGIQATQEFIELVQAKVEELGGRPANFHPRPETMSRVPWYSRSAD
SHYLTPKRSFVFGVASHALAVARMMEEEIGMRPLAVGTFSYEHAPAFLDECTRRGWNGFY
SDDFKEVERRIADAMPDIVLGTQMERHSARRHELPATVISCPAHVTDFPARYSPFAGWEG
ANVIFDAVTHTLTLGLESHLINMFRELPGVEHDSVLGAVRLPDLPPSPSPMSRNEGVPAE
QRGTASAVVSTPATTAVVTAPGTGTPGGEWSGEPRWTEEALAELKKIPFFVRKKAMHNTE
KYAREHGLREILPQTIHATRDELSRK
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgattgaccggcagtgtggctttccaagcgtgacgaacgtcagttacgggcggaaggaa
gtctccacgacgggcgtggaccggatgatgacggtcgtggaacaggtcgagcggacacac
aaaccgcgtgtcatccaggtcatccccacctgcacatccaacctgctcaaggaggatgtg
ggcggcgcgctcaaccgaatgcaggcgacgtgcaacgccaagctgctgtttttgcagctc
aatgccttctgcgaaaaagaagaccagggcgcggatatgacctttgccggcctcgtcgaa
cacctggcgaccggcacgggcgagcggacgcccgaacccacagtcaacattctggggctc
accagcctgggctttcgccaccgggatgacctgcgtgaaatcacacagcttctgaatcag
tgtgggattcgggtcaatgccgcccttccccttggcggtacggcggccgacttccagcgg
cttggacaggcctggttcaatgtcgtgccctacgctgaaatcgggttgcgcgccgcccgg
gttctcgaaaaccgctttgggcaaccctatctggtacacgcgccgattgggattcaggcc
acgcaggaattcatcgaactggtacaggctaaggtcgaggaactgggcggccgcccggcc
aacttccatccacgcccggagacgatgagccgggttccgtggtactcgcgctcggccgac
agccactacctgacacccaagcggtcatttgtctttggcgtagcttcccacgcgctggcc
gtggcgcggatgatggaagaagaaatcggcatgcgcccgctggccgtcggcacgttctct
tacgaacatgccccggcgtttctcgacgaatgcacccggcgcggctggaacggcttttac
tcggatgacttcaaggaagtggagcgccggattgccgacgcgatgcccgatattgtcctg
ggcacccagatggagcggcactcggcccggcggcacgaactgccagcgacggtcatcagt
tgtccagcccacgtcacggattttcctgcccgctattctccatttgcaggttgggaaggg
gctaatgtaatcttcgacgcggtaacgcatacattgacgcttggtttggaatcgcacttg
atcaatatgttccgcgaattgccgggtgtagaacatgactcggtactcggtgctgtaagg
ttgccagacctgcccccttccccctcaccgatgagccggaatgagggcgtcccggctgaa
cagcgcgggacagcgtcagcagtggtttccacaccggcgacgactgccgttgtcaccgcc
cccggaaccgggacacccggcggcgaatggtcaggtgagccacggtggacggaagaagcg
ctcgcggagttgaaaaaaatccccttctttgtccgcaagaaggcgatgcacaacaccgaa
aagtacgcgcgtgagcatggccttcgtgaaattcttccccaaacgattcatgccacgcgg
gatgagctgtcgcgcaagtga

DBGET integrated database retrieval system