KEGG   Chloracidobacterium thermophilum: Cabther_A1435Help
Entry
Cabther_A1435     CDS       T01629                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00480  Glutathione metabolism
ctm00590  Arachidonic acid metabolism
ctm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Cabther_A1435
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Cabther_A1435
Enzymes [BR:ctm01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Cabther_A1435
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: AEP12186
UniProt: G2LHC3
Position
1:complement(1705298..1705948)
Genome map
AA seq 216 aa AA seqDB search
MLFSLALTALLGAGCMAAADPARSSATSQPEGGTSPVTSPADTNPNPTPGCPPALDFTMK
SIDGKDINLCTYKGNVLLIVNVASRCGYTPQYKGLEALNQKYRARGLRVLGFPSNDFGAQ
EPGTDAEIKEFCTSNYGVQFDMFSKITVKGPNKHPLYQYLTSGGGNEKLAGEVRWNFQKY
LIGRDGKLRAVFPSSVDPMSDELTKAIEAALAEPAA
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgttgttttcactggcgctgacggcgttgctcggcgctggctgcatggccgcggccgac
ccggcgcggtcatccgcaacgtcccaacccgaaggaggtacctcacctgtgaccagccct
gctgacacgaatcccaatcctacgcccggctgcccaccggcgctcgacttcacgatgaag
agcattgatggcaaggacatcaacctgtgtacgtacaagggcaacgtcctgctcatcgtc
aatgtcgcctcccgctgtgggtacacgccgcagtacaagggactcgaagccctcaaccag
aagtaccgtgccagggggctgcgtgtgctgggtttcccatcgaatgactttggcgcccag
gagccgggcacggatgcggaaatcaaggaattctgcacctcaaactatggtgtgcagttc
gatatgttctcgaaaatcaccgtcaagggaccgaacaagcacccgctttaccagtacctc
acctctggcgggggcaatgaaaagctggccggcgaagtccgctggaactttcagaagtat
ctcatcggacgggatggcaagctgcgggcggtgtttccatcaagcgttgatccgatgtcg
gatgagctgacaaaggccattgaagccgcgttggccgaaccggcggcgtaa

DBGET integrated database retrieval system