KEGG   Chloracidobacterium thermophilum: Cabther_A2182Help
Entry
Cabther_A2182     CDS       T01629                                 

Definition
(GenBank) putative phosphotransferase, Ser/Thr protein kinases like protein
  KO
K07102  N-acetylmuramate 1-kinase [EC:2.7.1.221]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00520  Amino sugar and nucleotide sugar metabolism
ctm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Cabther_A2182
Enzymes [BR:ctm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.221  N-acetylmuramate 1-kinase
     Cabther_A2182
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: APH Choline_kinase EcKinase DUF1679 APH_6_hur
Motif
Other DBs
NCBI-ProteinID: AEP12920
UniProt: G2LDR2
Position
1:2580545..2581654
Genome map
AA seq 369 aa AA seqDB search
MNSPNDNNRLPRPTDKLTAFLSEHFPAAILSIEPLLGDASTRMYFRIRRERETFIAAVYA
EPFDVTTFAYLDVTRLFQSAGIPVPQVFAVDGRRGVVLQQDVGDWRLQDVLTNQPDVARR
VDYDLALHLIVDIQKTTPLAQACNSVAWRQAFDDEKLFWEMNYFFRNYVERYGRWVLSAE
QEALVLGELFALTYRLARVPRVVCHRDYHARNLMHHAGRLWVIDHQDARMGPATYDLASL
LGDPYAALDEDFQATLRERFWQLHRAAFGAQYYASRRQFEQEYQLMLVQRLLKAIGTYAY
QFAVRNNPVYLGYIPIALHTTARALEGIADLPMVKWLVESAIEREAPRAAAAPEVAFTAP
LPTTPLAGT
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaattcacccaacgacaacaaccgactcccgcgcccgacggacaagctcaccgctttc
ctcagtgaacacttcccggcggccatcctctccatcgaacccctcctgggtgatgcgtca
acccgcatgtacttccgcattcgccgggagcgtgaaaccttcattgcggcggtctatgcc
gaaccgtttgatgtcacgacatttgcctacctggatgtcacccggcttttccagtcggcc
ggcattcctgtgccccaggtgtttgcggtggatggccgccggggtgtggtgcttcagcag
gatgtcggtgactggcggcttcaggatgtgctgaccaatcaaccggacgtggcccgccgg
gtggactacgacctggcgcttcacctgattgtggatatccagaagacaaccccactggcc
caggcctgcaactctgtcgcctggcggcaggcgtttgacgacgaaaagctgttctgggaa
atgaactactttttccgtaactacgtcgaacgctacggccgctgggtgttgtcggcggaa
caggaagctctggtgctgggcgaactctttgccctcacctaccgtctggcgcgggtcccg
cgcgttgtctgtcaccgcgactaccacgcgcgcaacctcatgcaccacgccggacggctc
tgggtcattgatcatcaggatgcccgcatggggccggccacttacgatctggcctcgctt
ctgggtgacccctacgcggcactggacgaggactttcaggccacactcagggagcggttc
tggcagctccaccgggctgcctttggcgcgcaatactacgcctcccgccgccagttcgag
caggaataccaactcatgctggtgcaacgcctgctcaaggccattgggacctatgcctat
cagttcgccgtgcgcaacaatccggtttatttgggctacatcccgattgccctgcacacg
acggcccgtgctctggaaggcattgccgacctgcccatggtgaagtggctcgtcgagtcg
gctatcgagcgtgaggcgccacgggctgccgctgcgccggaagtggccttcacggcgccc
cttcccacaacacctctggccggtacgtga

DBGET integrated database retrieval system