KEGG   Chloracidobacterium thermophilum: Cabther_B0662Help
Entry
Cabther_B0662     CDS       T01629                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm00010  Glycolysis / Gluconeogenesis
ctm00620  Pyruvate metabolism
ctm00640  Propanoate metabolism
ctm00680  Methane metabolism
ctm01100  Metabolic pathways
ctm01110  Biosynthesis of secondary metabolites
ctm01120  Microbial metabolism in diverse environments
ctm01130  Biosynthesis of antibiotics
ctm01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ctm00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cabther_B0662
   00620 Pyruvate metabolism
    Cabther_B0662
   00640 Propanoate metabolism
    Cabther_B0662
  Energy metabolism
   00680 Methane metabolism
    Cabther_B0662
Enzymes [BR:ctm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Cabther_B0662
Lipid biosynthesis proteins [BR:ctm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Cabther_B0662
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEP13660
UniProt: G2LKQ3
Position
2:798812..800761
Genome map
AA seq 649 aa AA seqDB search
MTESYAIESHQHETRQFPPPPDFARQANVTPELAAQLYAEAEADFEAFWAKQAEALDWMT
PWTHVLEWNPPHAKWFIGGKLNISANCLDRHLKTWRRTKAAIVWEGEPGDTRTLTYWELH
REVCRFANVLKKFGVRAGDRVAIYMPMTPEIAIAMLACARIGATHSVVFGGFSAEALRDR
INDAGCKLVVTADGCWRRGTEVRLKPAVDAALEQTPTVETCLVLRRTGSKVDMQPGRDHW
WHEMLETVGDDCPPEALDAEHPLFILYTSGTTGKPKGILHTTGGYLTQVAATARWVLDLK
DDDVYWCTADVGWVTGHSYVVYGPLANGATVMMYEGAPNHPEPDRFWRIVDRHGVTILYT
APTAIRAFIRWGEQWVLKHRLDSLRLLGTVGEPINPEAWMWYRQVVGKGRCPIVDTWWQT
ETGGMMIAPLPGATTTTPGTATRPLPGISADIRLKDGRSVDANEGGYLVLTRPWPAMLRT
IWGDDERYRRQYWSEIEGVYFAGDGARRDEHGNYWIMGRVDDVINVSGHRLGTAEIESAL
VSHEAVAEAAVVGRPDELKGSAIVAFVTLQGGRAGDDALRAALREHVAKEIGALAKPDDI
RFTDALPKTRSGKIMRRLLREIAASGNVVGDVTTLEDFSVLEKLRADED
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgactgaatcctatgccatcgagtctcaccagcatgaaaccagacagtttccaccgccg
ccggactttgcccggcaggccaacgtcacgccggaactcgccgcccaactctatgccgaa
gcggaagctgacttcgaggctttctgggccaaacaggcggaggccctcgactggatgacg
ccctggacgcacgttctggagtggaacccaccccacgccaagtggttcatcggcggcaaa
ctcaacatttctgccaactgccttgaccgtcacctgaaaacctggcggcgcacgaaagcg
gccatcgtgtgggaaggcgagccgggcgacacccggacgctgacgtactgggaattgcac
cgcgaagtctgccggtttgccaatgttctgaagaagtttggcgtccgggccggcgaccgc
gtggccatttacatgccgatgacgccggaaatcgccatcgccatgctggcctgcgcccgc
atcggggcgacacactccgtcgttttcggcggtttctcggctgaagccctgcgcgaccgc
atcaacgacgccggctgcaaacttgtcgtcacggccgacggctgctggcgacgcgggacg
gaagtccgcctcaaaccggccgtggatgcggcccttgagcaaacgccaaccgttgaaacc
tgtctcgtgttgcgacgcaccggctcgaaggtggacatgcagcccggacgcgatcactgg
tggcacgaaatgctcgaaacggtaggcgacgactgtccgccggaagcgctcgatgccgaa
catccgctgttcatcctctacaccagcggcacgaccggcaaacccaagggcatcctgcac
acgacgggcggctacctgacacaggtggcggccacggcccggtgggtgctcgacctcaag
gacgatgatgtgtactggtgcacggccgatgtcggctgggtgacaggccacagctacgtc
gtctatgggccgctggccaacggggccacggtgatgatgtacgaaggcgcgcccaaccat
cctgagccggaccgcttctggcgcatcgtggaccgccacggcgtgacgattctttacacc
gccccgactgccatccgggcgtttatccgctggggggagcagtgggtgctgaaacatcgc
ctcgacagcctgcgcctgcttggtacggttggcgaacccatcaaccccgaagcctggatg
tggtatcgccaggtggtggggaaaggacgctgccccatcgtggacacctggtggcaaacc
gaaaccggcggcatgatgattgcgcccctgccgggggccacgacgacgacgcccggtacg
gccacccgtccgctgccgggcatcagcgccgatattcgtctgaaagacggccgctcggtt
gatgccaacgaaggaggctatctcgttctgacgcggccctggcccgcgatgctgcgtacc
atctggggcgacgacgaacgctaccgccggcaatactggagcgagatcgaaggcgtctat
tttgctggcgacggcgcacggcgcgatgaacatggcaactactggatcatggggcgggtg
gatgatgtcatcaacgtcagcggccaccggctgggcacggctgaaatcgaaagcgcgctg
gtgtcgcacgaagccgtggccgaggcggcggtcgtcggccggcctgatgaactcaaaggc
tcagcgattgtggcgtttgtcacgcttcagggcggccgggccggggatgatgccctccgg
gctgccctgcgcgagcatgtggcgaaggaaatcggcgcgctggccaagccggacgacatc
cgctttaccgatgcactgcccaagacgcgctccggtaaaatcatgcgccgcctgctgcgc
gaaatcgccgccagcggcaatgtcgtcggggatgtcaccacgctggaggatttttcggta
ctcgaaaagctccgcgctgatgaggattga

DBGET integrated database retrieval system