KEGG   Chloracidobacterium thermophilum: Cabther_B0807Help
Entry
Cabther_B0807     CDS       T01629                                 

Definition
(GenBank) Periplasmic protein involved in polysaccharide export
  KO
K01991  polysaccharide biosynthesis/export protein
Organism
ctm  Chloracidobacterium thermophilum
Pathway
ctm02020  Two-component system
Brite
KEGG Orthology (KO) [BR:ctm00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Cabther_B0807
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ctm02000]
    Cabther_B0807
Transporters [BR:ctm02000]
 Other transporters
  Pores ion channels [TC:1]
   Cabther_B0807
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Poly_export SLBB
Motif
Other DBs
NCBI-ProteinID: AEP13804
UniProt: G2LLK8
Position
2:complement(970489..971535)
Genome map
AA seq 348 aa AA seqDB search
MLYLALWLLALPGLAGFSFAQETAPNPPSFPPVMPSPAVRATQVYTAPTGDYVIGPGDVV
DIKVFKQPDLTGRFRVGDSGSVELLFIGKQQLAGLTESEAADLLRQELRKYLRQPEVSVT
VTEFNSRLVTVIGAVRTPGRQPLRRAMRLLDVIALAGGLAEDSSRFVNVIRYVSKPAEEA
QPALGAAPTPEPDEDVPPDVEILSINIDDIIAGNAKNNLLLQPGDIISVPRADVVYLAGN
VRKPGPITARNPITVTQAIAMASGLAEGAKRNDIRLYRTVPGKLEREEIKISLAAIQSGK
QKDLVLQANDVLYVPHSELRSAGTTVMRSLPTLVTSALIPLLTTAIIR
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgctttaccttgcgttatggttgttggcgttgccggggctggccggcttcagttttgcc
caggagacagcgccgaatccaccttcatttccgccggtgatgcccagcccggccgtgcgg
gccacccaggtctatacagcgccaactggggactacgtgattgggccgggggatgtcgtg
gacatcaaggtgttcaagcagcccgatctgacggggcgcttccgggtgggcgacagcggc
agcgtcgagctgctgttcattggcaaacagcagttggccgggctgaccgagagcgaagcc
gccgatttgctgcggcaggagttgcggaagtatctccggcagccggaagtcagtgttacg
gtgacggaattcaactcgcggctcgtgaccgtgattggcgccgtccgcacgccgggacgg
cagccgctgcggcgcgccatgcgcctgctcgatgtcattgccttggcaggggggcttgcc
gaagactccagccgctttgtcaatgtcatccgctacgtgtcaaaaccggcggaagaagcc
cagccggcactgggagccgcaccgacaccggagccagatgaggatgtgccaccggatgtc
gaaattctttccatcaacattgatgacatcatcgccggcaatgccaaaaacaaccttctg
ttacagccgggggacatcatttccgtaccacgagccgatgtcgtctatctggccgggaat
gtgcgcaagcccggtcccattacggcacgcaacccgattactgtcacgcaggcgattgct
atggccagcgggctggccgagggagccaaacgcaatgacattcgcctctaccggacggtt
cccggcaagctggagcgtgaagaaatcaagatcagcctcgccgcgattcagtccgggaaa
cagaaagacctggtgttgcaggctaacgacgtgctttacgtgccccattccgaactgcgg
tcggctggaacaaccgtgatgcgcagcctgcctacacttgtcacttcagcactcattccc
cttctgacgaccgccatcatccggtaa

DBGET integrated database retrieval system