KEGG   Chlamydia trachomatis RC-J/966: CTRC966_03440Help
Entry
CTRC966_03440     CDS       T02768                                 

Definition
(GenBank) exodeoxyribonuclease V alpha chain
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ctmj  Chlamydia trachomatis RC-J/966
Pathway
ctmj03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:ctmj00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    CTRC966_03440
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ctmj03400]
    CTRC966_03440
Enzymes [BR:ctmj01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     CTRC966_03440
DNA repair and recombination proteins [BR:ctmj03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     CTRC966_03440
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 UvrD_C_2 Viral_helicase1 PIF1 AAA_11 PhoH UvrD-helicase DUF2075 Helicase_RecD AAA_25 AAA_22 UvrD_C IstB_IS21 AAA ATPase
Motif
Other DBs
NCBI-ProteinID: AGS01547
Position
744850..746340
Genome map
AA seq 496 aa AA seqDB search
MNVNQHVQDIVQSLLAQHILLPFDIAFAQKHISQEEVSQEAEAFLATASALLRCGYPYFS
ICDKTIHPTLPGISSKQLFEWFQVLSSRIKEELFEVVNHKIYLRSLFLLREKVFHKLHRL
AGAVPRTPLIFEEIAQLSEEQNQVLKTVLNSCFSLVCGGPGTGKTFLAVQMIRLILAQIP
SAQIVVASPTGKASAHLHSVLTSQGIVGDSVEVVTIHKFLKDMRRGCSPVDLLLVDEGSM
VTINLLHGLIKTIRGEARGETIYADRMVIFGDANQLPPIGIGVGNPFHEVVSEFSKQACF
LSTSHRAKHKELQELASAVLRKELIPFQPLPSRQEAIRRLSFAFTQAAKEGVSLCALTPM
RQGLWGFLQLNRLLFNEMQEKHPQAPIPIIVTERYETWGLMNGDTGVLDPVTQQLRFTNG
EILHQADFPYYSYNYVMSVHKSQGSEYDRVIVILPKGSEVFDSAILYTAITRTKQHVEIW
ADREALEAIILKRGRY
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
gtgaatgtaaatcagcacgttcaagatattgtacaatctttgttagcacaacatattctt
ctcccttttgatatagcctttgctcaaaagcatatatcccaggaggaggttagtcaggaa
gcagaggctttcttagctacagcctctgcattattgcgttgtggatatccttatttttct
atctgtgataagacgattcatcccacgctcccagggatttcaagtaaacaactcttcgaa
tggttccaagtgttatcttctcgtataaaagaagaactgtttgaagtcgttaatcataaa
atctacctacgctcattatttcttttacgggagaaagtgtttcataagttgcataggttg
gcaggagctgtaccacgcacgcccttgatttttgaagagattgcacagctctcggaagag
cagaaccaggtacttaaaactgtattaaactcctgcttctctctcgtttgtggaggacca
ggaacaggaaaaacatttttagcagttcagatgattcggttgatacttgcgcaaattcct
tcagcgcagattgtagtagcttccccaacggggaaagcttccgctcatctgcatagcgta
ttaacatctcaggggatcgttggagattctgtagaagtcgttacgattcataaattttta
aaagatatgcgtagagggtgctcccctgtagatctactattggttgatgaaggatcgatg
gtgaccataaatctgttacatggactaatcaaaaccatacgaggagaagctcgaggggaa
acgatctatgcagatagaatggtgatttttggggatgcgaatcagcttcctccaataggt
attggagtgggaaatccttttcatgaagtagtgtctgagttttctaaacaggcatgcttt
ttatctaccagccaccgagctaaacataaggaattgcaggaattagcgagcgctgttctg
cgcaaggagctgattccttttcaacctttgccttcccgacaagaagctattcggcgattg
tcttttgcttttacacaagcagcaaaagaaggggtgtcgttatgtgctttgactccgatg
cgccaaggactttgggggtttttgcagttgaatcggttgttgtttaatgagatgcaggag
aaacatccgcaggcgcctattcctatcatcgtgacagaaagatatgaaacgtggggatta
atgaatggggatacaggagttttagatcctgtaacgcaacaattgcgtttcacgaatggg
gagattctgcatcaagcagattttccctattattcttacaactatgtcatgtctgtgcac
aaaagtcagggtagtgaatatgatcgtgtgattgtcattcttcctaaaggcagtgaagtc
tttgattcggcaattctctatactgcaattacaagaaccaaacaacacgttgagatttgg
gctgatcgagaagctttagaggcgatcattttgaaaagagggcgttattaa

DBGET integrated database retrieval system