KEGG   Chlamydia trachomatis RC-J/966: CTRC966_04285Help
Entry
CTRC966_04285     CDS       T02768                                 

Definition
(GenBank) exported insulinase/protease
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
ctmj  Chlamydia trachomatis RC-J/966
Brite
KEGG Orthology (KO) [BR:ctmj00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:ctmj01002]
    CTRC966_04285
Enzymes [BR:ctmj01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     CTRC966_04285
Peptidases and inhibitors [BR:ctmj01002]
 Metallo peptidases
  Family M16: pitrilysin family
   CTRC966_04285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C
Motif
Other DBs
NCBI-ProteinID: AGS01714
Position
complement(938959..941829)
Genome map
AA seq 956 aa AA seqDB search
MDNHLPVINDPTNDPKNMKRSLSLLLLCIPSFLTACSKSFQTIRDENPLTILTPALADQK
IAKILCPNGLSLMIVSSPHAAESGAALVVKTGNNADPVEFPGLAHFTEHCVFLGNEKYPE
PSGFPAFLSTHGGIYNAFTYPDKTCFLFSVNNADLDNALDQFVHLFIQPLFRQEDLNKEV
HAVEQEFAMHPTKDSRRMHRIQQLIAPKNHPLKRFGCGNLSTLNSVTTQDMQTWFATHYS
PENMAAIVYTTAPLDTAVPYIASLFSEIPISAQYTPQKPFPKTQDTTALNKLFINKAVEP
SPQLAIYWHFYDAPQSLQGWAQSLISILSSEKENSLVALLKKEQLITEMEAELYSTSHNT
QDFEILYKLTNKGEREYQRVLQLTFAFLDYVRHERLPAYSLPEIQKINSLEYTYSTQTEL
FSTLSRMVPNFTSEPLATYPYRSLVYPEYSQEDEQTFATFLADPQQARYILSATLPSSWE
NADEFYDPIFDDTFYEKPLDFTPIQDSSSLGFAFPNPNKFIPQTVQLLSQKKQHEGFAFS
PQLTYDQNAITLYTCEDSFYTIPKIAMELRIRSPQIQRTDVRSLVLRDLYSLLANETLIK
RYDDALKAGMTFAVSPGATGVDLSLLGYTETSPVLINALLSSLRDLPVEESLFLYYKDQL
SEQYQKNLIACPIRAGLNKLYSQILVDTVSLEDKLNTLNTLSYEEFANFTNKLLQELAVE
SLALGTLSAQDLSNLLSTLSNFAEASSPYAAPSYYPQRKPLSSTKLSFQYPLSGNGMLLL
EQNEDPHQYKDSVATSMLLSWIHNLYFSDLRTEQQLGYMVGSKYLEFAETPCGLFYIRSN
NYSPEELVHRTQLFIQKIATDPESAGLSEEIFEQLRETYIQSILLPSSTPLAMAKKLFSI
AFETKKQDFSRPDQKIAAARSMDYSYFKKYCEEFLSQKFGPEIQLLVYGANSSQEK
NT seq 2871 nt NT seq  +upstreamnt  +downstreamnt
atggacaaccaccttcctgttatcaatgaccctaccaatgaccccaaaaatatgaagcgt
tccctatccctattacttctttgcattccttcttttctaactgcttgctcgaaatccttt
caaacgattcgagatgaaaaccctttgactattttgacccctgcattagcagatcaaaaa
attgctaaaattctatgccctaacggactctctctcatgattgtatcctcccctcatgct
gctgagtccggagccgctttagttgtcaaaacaggaaataatgcagatcctgtcgaattc
ccaggcttagcccattttacagaacactgtgtgttcctcgggaatgaaaaatatcccgag
ccctcaggatttcctgccttcctaagcacacatgggggtatctataacgcatttacttac
ccagataaaacctgcttcctattctccgtaaacaatgcagatttagataatgctctggat
cagtttgtacatctctttatccaacctctcttccgccaagaagatttaaacaaagaagtt
catgctgttgagcaagaatttgcgatgcatccaactaaagattctcgtcgtatgcatcgt
attcaacaacttatagctcctaaaaatcacccattaaaacgctttggctgcggcaatctc
tctaccctcaactccgtcactactcaagatatgcaaacatggtttgccactcactactct
ccagaaaatatggcagcaattgtttacactacagctccgttggacaccgcagtgccgtat
atcgcgtccctattctctgaaatccctatatctgcacagtacacaccacaaaaaccgttt
ccaaagacacaagatactactgctcttaataaactgttcatcaataaggctgtcgaacct
tctccacaactagctatttactggcatttttatgatgctccacagtccttacaaggatgg
gctcagtcactgatttctattttatctagtgaaaaagaaaatagtcttgttgctttactc
aaaaaagaacagctcattactgagatggaagcagaactttacagcacttctcataataca
caagattttgaaattctttataaactcaccaataagggggaacgcgaatatcaaagagtt
ttgcagctaacttttgcttttcttgattatgttcgtcatgaacgacttcctgcctactcc
ttgccagagatacagaaaatcaactctttagaatatacttacagcacgcaaaccgagtta
ttctcgacactatcacgaatggtccccaattttacttctgaaccattagcaacataccct
tatcgctctcttgtctatccagaatactcccaagaagatgaacaaacctttgctacattt
ttagcagaccctcaacaggcacgttatatcttatctgctaccctaccgagttcttgggag
aatgcagatgaattctatgatcccatctttgacgacactttctatgaaaaacccttagat
ttcacacctatacaggactcctcctccttaggatttgcttttccaaatcccaataaattt
attcctcaaacagtccaattattatctcaaaagaaacaacacgaagggtttgctttttct
ccgcagctgacctatgatcaaaatgcgatcactttatatacttgtgaagactctttctat
acgattcctaaaatagctatggagttgcgcatccgttctcctcaaattcaacgaacagat
gtgcgttctttagtattacgagacctatatagtctactagctaatgaaacattaataaaa
cgttatgacgatgctttaaaagctggaatgacttttgcagtatctcctggagcgacagga
gttgatctttctcttttaggatatactgagacctctcctgttcttatcaatgctttactg
tcttctttacgagatcttcctgtggaagaaagtctgtttctatattacaaagatcagcta
tcagaacaatatcagaagaatcttattgcctgccctataagagctggtctcaataaacta
tactctcagattcttgttgataccgtttccttagaagataagctcaatactttaaacacc
ctctcctacgaagagtttgcgaacttcacgaataaactactccaagaactagctgtagaa
tctttagcactaggaacgctctcggctcaagatctctccaatttattatcgactctctct
aactttgcagaagcttcgtctccttatgctgctcctagctattatcctcaaagaaaacct
ctctcttctacaaagctttcgttccaatatcctctctctggaaatggtatgctgctgctc
gaacaaaacgaagatccccatcaatataaggactctgtagctactagtatgttgttatct
tggatccataacttgtacttctctgatttacgtacagagcaacaacttgggtatatggta
ggttctaaatatctggaattcgcagaaactccttgtggacttttctatattcgatccaat
aactattctcctgaggagcttgtgcatagaacacaactctttatacaaaagattgctact
gatccagaatctgcaggcttgtccgaagagatctttgaacagcttcgagaaacatatatc
cagtccatattgcttccaagttccacacctttagctatggcgaaaaaattattctctata
gcttttgaaacgaaaaaacaggatttttctcgcccagaccaaaaaatagctgctgcccgt
tctatggattacagctatttcaaaaagtactgtgaagaatttttgagtcaaaagtttggc
ccagaaatccaactcctcgtctatggagccaactcgtcgcaggaaaaataa

DBGET integrated database retrieval system