KEGG   Chlamydia trachomatis L2c: CTL2C_571Help
Entry
CTL2C_571         CDS       T01574                                 

Gene name
lpxB
Definition
(GenBank) lipid-A-disaccharide synthase
  KO
K00748  lipid-A-disaccharide synthase [EC:2.4.1.182]
Organism
cto  Chlamydia trachomatis L2c
Pathway
cto00540  Lipopolysaccharide biosynthesis
cto01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cto00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    CTL2C_571 (lpxB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cto01003]
    CTL2C_571 (lpxB)
   01005 Lipopolysaccharide biosynthesis proteins [BR:cto01005]
    CTL2C_571 (lpxB)
Enzymes [BR:cto01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.182  lipid-A-disaccharide synthase
     CTL2C_571 (lpxB)
Glycosyltransferases [BR:cto01003]
 Polysaccharide
  Bacterial polysaccharide
   CTL2C_571 (lpxB)
Lipopolysaccharide biosynthesis proteins [BR:cto01005]
 Lipid A
  CTL2C_571 (lpxB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LpxB LAB_N
Motif
Other DBs
NCBI-ProteinID: AEJ77490
Position
787640..789463
Genome map
AA seq 607 aa AA seqDB search
MFPQKITLWLYPLGLFANLFFGTAFCVQWFLTRKKGYSVVPKIFWYLSGTGAVFMICHGF
IQSQYPIALLHSFNLIIYFRNLNIASLNPLPVSKIASLLVSVATAITVSFAIGTRYLHHM
TWMASPNILHLNLPEASLSWQLIGCIGLTIFSLRFFIQWFYLEYKNQSALPAPFWKASLL
GGSICLLYFLRTGDLVNVLCYGCGLFPSLANLRIASREAFRKPFSNSCFISAGEHSGDTL
GGNLLKEMHAKYPDIHCFGVGGPQMRAQNFHALFTMEKFQVSGFWEVLLALPKLWYRYQL
LYRNILKTNPRTVICIDFPDFHFLLIKKLRSRGYKGKIVHYVCPSIWAWRPSRKTVLEKY
LDLLLLILPFEQNLFKDSALRTVYLGHPLSETIKSFSPNLNWKDQLHLPTDKPFIAAFPG
SRRSDILRNLTIQVQAFQASSLASTHHLLVSSANPEYDHLILEVLQQNRCLHSHIVPSQF
RYELMRECDFALAKCGTIVLETALNLTPTIVTCQLRPLDTFLAKYIFNIILPAYSLPNII
LGRTIFPEFIGGKKDFQYEDVAAALNILKTSQAQEKQKDSCRDVYQAINESASSMKECLS
LIFETAS
NT seq 1824 nt NT seq  +upstreamnt  +downstreamnt
atgtttccccaaaaaattacactctggttataccctctaggactattcgccaacctcttc
tttggcacagctttttgtgttcaatggtttttaactagaaagaaagggtattctgtcgtt
cccaagattttttggtatctgtccggtaccggcgccgttttcatgatttgccacggattt
attcaaagtcagtatcctattgctttgttgcattcgtttaatctgattatttatttccgg
aacctgaatatcgcctctctaaatccccttcctgtttcgaaaatagcttctctactagtc
tcagtagcaacagcgatcacggtatcttttgctattggaacgcgttacctccatcatatg
acgtggatggcatccccaaatatcctccatttgaatctaccagaagcgagtttgtcatgg
cagctgataggatgtatcggattgacgatcttctcattgagatttttcatccagtggttc
tatctcgaatacaaaaaccaatccgccctgcccgctcctttttggaaagcaagcctacta
ggaggatctatctgccttctctatttcctaagaacgggggatctcgtaaacgtgttatgt
tatggatgcgggttattcccttctttagcaaatctacgtatcgcttcacgagaagctttc
cgcaaaccttttagcaatagctgctttatttctgcgggcgaacatagtggagatactttg
ggagggaatttattaaaagaaatgcacgcaaaataccctgatattcattgctttggcgtg
gggggaccgcaaatgcgtgcacagaattttcatgcacttttcactatggagaaatttcag
gttagcggattctgggaagtacttttagcactacctaaattatggtaccgctatcagctt
ctctatagaaatattctgaaaacaaatccgcgcacagtgatttgcattgatttccctgat
tttcatttcttattaataaaaaaattacgctctcgaggatataaaggaaagattgttcac
tatgtatgccctagcatatgggcttggagaccttcacggaaaacagttttggaaaaatat
ctagacctgcttttactaatacttccttttgaacaaaacttattcaaagattcagctctg
cgtacagtctatttagggcatcctctttctgaaacaattaaaagcttttctcccaatcta
aattggaaagatcagctccatcttcctaccgataaacctttcattgcagcgtttcctggt
agccgtcgcagcgatatcctgcgtaatctaaccattcaagtgcaggcctttcaagcatcc
tctcttgcatccacacaccatttacttgtatcgtctgcaaatccggaatatgaccatctt
atcctcgaagtgcttcaacagaatcggtgtttgcacagtcatattgttccttcccagttt
cgttatgaattaatgagagaatgtgattttgccctcgccaaatgtggaactatcgtccta
gaaacggctctcaatctaactcctacgatcgtcacttgccagctccgacctttggatact
tttttagctaagtatatctttaatattatccttccagcctactcgctccctaatatcatt
ctaggcagaacgatttttcctgaattcataggtgggaaaaaagattttcaatatgaagat
gttgctgctgctctaaacattctgaaaacatctcaagctcaagaaaaacaaaaagactct
tgcagagatgtgtatcaagcaatcaatgaatctgcatcctctatgaaagagtgtctttct
ctcatattcgaaacagcttcctaa

DBGET integrated database retrieval system