KEGG   Chlamydia trachomatis L2c: CTL2C_731Help
Entry
CTL2C_731         CDS       T01574                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
cto  Chlamydia trachomatis L2c
Pathway
cto00260  Glycine, serine and threonine metabolism
cto00400  Phenylalanine, tyrosine and tryptophan biosynthesis
cto01100  Metabolic pathways
cto01110  Biosynthesis of secondary metabolites
cto01130  Biosynthesis of antibiotics
cto01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:cto00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    CTL2C_731 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    CTL2C_731 (trpB)
Enzymes [BR:cto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     CTL2C_731 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Gmad2
Motif
Other DBs
NCBI-ProteinID: AEJ77650
UniProt: F9YDM3
Position
511749..512927
Genome map
AA seq 392 aa AA seqDB search
MFKHKHPFGGAFLPEELLAPIQNLKAEWEILKTQQSFLSELDCILKNYAGRQTPLTEVKN
FARAIDGPRVFLKREDLLHTGAHKLNNALGQCLLAKYLGKTRVVAETGAGQHGVATATAC
AYLGLDCVVYMGAKDVERQKPNVEKMRFLGAEVVSVTKGSCGLKDAVNQALQDWATTHSF
THYCLGSALGPLPYPDIVRFFQSVISAEVKEQIHAVAGRDPDILIACIGGGSNAIGFFHH
FIPNPKVQLIGVEGGGLGISSGKHAARFATGRPGVFHGFYSYLLQDDDGQVLQTHSISAG
LDYPSVGPDHAEMHESGRAFYTLATDEEALRAFFLLTRNEGIIPALESSHALAHLVSIAP
SLPKEQIVIVNLSGRGDKDLPQIIRRNRGIYE
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgttcaaacataaacatccttttgggggagcgttccttcccgaagaactattagcccct
atacagaatctaaaagcggaatgggagattctcaaaactcagcaaagttttttatctgaa
ctagattgtattttgaaaaactatgcggggagacaaactcctctgactgaagttaagaat
tttgctcgagctattgatggccctagagtatttcttaaacgcgaagatcttttgcataca
ggagcacataaactgaataatgctcttggtcagtgtttgcttgctaaatatcttgggaaa
acacgtgttgtagctgaaacaggtgcgggacaacatggagtagcaacagcaacagcgtgt
gcttatctaggattagattgtgtagtatacatgggagcaaaagatgtggaacgacagaaa
ccaaatgtagagaaaatgcgctttttaggtgctgaagtcgtttctgtaacaaaaggatct
tgtggactcaaagatgcagttaatcaagctctacaagattgggcaacaacacactcattt
actcactattgcttaggatcggccttaggacctttaccttatcccgatatcgttcgattt
tttcagtctgttataagcgctgaagtgaaagagcaaatccatgcagttgcaggaagagat
cctgatattctgattgcatgtatcggaggtggctccaacgctattggatttttccatcat
tttatcccgaatccaaaagtccaattaattggagtggaagggggaggactgggcatttct
tcaggaaaacatgcagcacgttttgcaacagggcgacctggagtattccacggattttat
tcgtatcttcttcaagatgacgatggacaagtattacaaactcactccatttccgctgga
ttagattatccttcagttgggccagatcatgccgaaatgcatgagtcaggacgagccttt
tatacattagccaccgatgaagaggcgttacgagcttttttcctgcttactagaaatgag
gggattattcctgcattggagtcttcacatgctctcgcacatttagtttcgattgctcct
tctctaccaaaggaacaaatcgtcatcgttaacttatctggaagaggtgataaggatctt
ccacaaatcatccgcagaaacagaggaatttatgagtaa

DBGET integrated database retrieval system