KEGG   Candida tropicalis: CTRG_01613Help
Entry
CTRG_01613        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K18670  dual specificity protein kinase YAK1 [EC:2.7.12.1]
Organism
ctp  Candida tropicalis
Brite
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     CTRG_01613
Protein kinases [BR:ctp01001]
 Serine/threonine kinases: CMGC group
  DYRK family [OT]
   CTRG_01613
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH Choline_kinase RIO1 Kdo
Motif
Other DBs
NCBI-GeneID: 8301263
NCBI-ProteinID: XP_002547307
UniProt: C5M6Y2
Position
Unknown
AA seq 726 aa AA seqDB search
MAYNNYNYNRHNSIGGSWHLPPPSYQQQQQQQQQQSQNPPHLQHQSSHPTLNQDVLGNPN
DQYQRPNQHMSGFRNPWYSQQQQQQQQASPSSSLLSSSSLSQSPTKSHQIPLLQQQQQPP
LNKRLSFANQLPTTYEYENDNNVPPFIHPPTRADNPFNQYFANQEVSLGSNDRRMSVAID
GTHYNPFGTFGQQNNAYPSGPAGVAGHQYLNNPNLGAIPGANRRSSLAVMPNHYRQQQGP
QQPIDPNSPAAAYYLPPARLGRSASIIQYQQYQQALQNSKVNKAYRPAPKARKIYNKMEL
TPKYHQQPKYRRCSVNSIHISPVNALSVYLTESYSICQPRKFQYSKSTNPKRVLTKPSEP
KFNNGYDNEDSDYILYVNDVLGSEEGKKYMVLDLLGSGTFGQVVKCQNLSNQSVCAVKVI
KSKPAYMNQSLTEVRLLEFLNTNSDGKSFIRLLDTFMHKEHLCLVFELLASNLYELIKQN
QFQGLNMKLVKIISKQLLEGLAQLKSFQMIHCDLKPENILLITGDKPTIKIIDFGSATFS
KNTIYSYIQSRFYRSPEVILGLSYGEAIDTWSLGCIVGELYLGLPLFPGTSEYNMLWKIQ
EMLGPPPRHMLLGRNSMNFYKKLPGKTPDDKPNYQIKTYEEYCQFLEQKKGSSAHEKENK
NYFKHKSLKDIIMNYRLPSKKMTNSMVEKEMRERELLVDFLTKVLNWNPIERLTPQEALK
HPWMNS
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atggcatataataactataattataataggcataactcaataggtgggagttggcacttg
cctcccccttcataccaacaacaacagcaacaacagcaacagcaatctcagaatccacca
catcttcaacatcaatcactgcatcctactttaaatcaagatgtattaggaaatccaaat
gatcaatatcaacgtcctaatcagcatatgtcaggtttcagaaacccgtggtattcccaa
caacaacagcaacagcagcaggcgagtccaagttcttccttgttatcttcatcatcttta
tcacaatcaccaacaaaatcgcatcagataccgttgttgcaacagcaacaacagccgcca
ttgaataagcggttgtcattcgccaatcagttgccaacaacctatgaatatgagaatgat
aataacgttcctcctttcattcatccaccaacgcgtgctgacaacccattcaaccaatac
tttgcaaatcaagaagtgtctctaggaagcaatgatcgtaggatgtctgttgctatagat
ggaactcattataatccatttggtacatttggccaacaaaacaatgcctatccatctggt
cctgcaggtgtagctggccatcaatacttgaacaatccaaatttgggagccattcctgga
gctaacagaagatcttcattagccgttatgcccaatcattatcgtcaacaacagggtcca
caacaaccaatagatccaaattcaccagctgcagcatattacctaccacctgctcgtctt
ggtagatcagctctgatcattcaataccagcaatatcaacaggctttacaaaacctgaaa
gtcaacaaggcatatcgaccagcaccaaaagctcgcaagatctacaacaaaatggaatta
acaccgaaataccaccaacaacctaaatatcgtcgatgttcagttaattccatccacatt
tctcctgttaatgcattatcggtatatttgaccgaatcgtacagcatatgtcagccacgt
aagttccaatattcaaaatccacaaatccaaagagagtattgaccaaaccgctggagccg
aaatttaataatgggtatgataacgaagacagtgactatatcttgtatgttaatgatgtc
ttgggcagtgaagaaggaaagaagtatatggtgttggatttattaggatcaggaacattt
ggacaagttgttaaatgtcagaatctttctaaccaaagtgtttgcgcggtcaaagtgatc
aaatccaaacctgcatacatgaatcaatcgctcacagaagtcaggttattggagtttttg
aataccaatagtgatgggaaaagtttcatccgtttgttggatacatttatgcacaaggaa
catctttgtttagtgtttgaattgttggcatccaatttgtacgaattgatcaaacagaat
caattccaaggtctcaatatgaaacttgttaaaattatcagtaaacaacttttggaagga
ttggctcagctaaagagtttccagatgatacattgtgatttgaagccagagaatatattg
ttaataactggagataaacctacgattaaaatcattgactttgggtctgctacgttttca
aaaaataccatatacagttatattcaatctcgtttttatcgaagtccagaggttattctt
ggattgagttacggagaagctatagacacttggtcattaggatgtatagtaggtgaactt
tatcttggtcttccattattcccaggtacatctgagtacaacatgctatggaaaatacaa
gaaatgttgggtccaccacctcgtcatatgcttctcggacgaaactcgatgaatttttat
aagaaacttcctgggaaaacaccagacgataaaccaaattatcagatcaagacctacgag
gaatactgtcaatttttagaacaaaagaaaggatcaagtgctcatgaaaaggagaataag
aactatttcaaacacaaatctttgaaggatattatcatgaattatagattaccatcaaag
aaaatgacaaattccatggttgaaaaagagatgcgtgaacgagaattgttggttgatttt
cttacaaaagtactcaattggaatcctattgaaagattaactccacaagaagcattgaaa
catccttggatgaattcatag

DBGET integrated database retrieval system