KEGG   Candida tropicalis: CTRG_02361Help
Entry
CTRG_02361        CDS       T01115                                 

Definition
(RefSeq) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_02361
Enzymes [BR:ctp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     CTRG_02361
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_M TPP_enzyme_C DXP_synthase_N E1_dh
Motif
Other DBs
NCBI-GeneID: 8301643
NCBI-ProteinID: XP_002548064
UniProt: C5MA49
Position
Unknown
AA seq 395 aa AA seqDB search
MVDVQVPVSKLEKPLNLTPPPNNQKIQSEVLDDIIRLIESAKDPVIIIDACCGRHNATPE
AQKLIELTKFKFAVTPMAKGSKDIDESDPKFIGCYVGDLSYPRVKELVENSDLVLSLGAV
LSDFNTGSFSYSLDNAKVVEFHSDYTQIKSAQYPGIRMKELLGKLVEDPNLIKTCSKIPA
KKLVTDNFEPLVLPPDHKLTQSWLWSNLGSWLKEGDVIVTETGTSNFGIVQTKFPKNAVG
ISQVLWGSIGYSVGSAAGAVIAAEEIDPNRRVILFVGDGSLQLTVQEISTMARHKNNIYI
FVLNNNGFTIERLIHGPEAVYNSIQEWENAELLKTFKATNYESFTVKTVGELDKVFKDKK
FAVNDKIRLVEIKLDTLDAPENLVKQAERSASTNK
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggttgacgtccaagtcccagttagcaaattagaaaaaccattgaatttaactccacct
cctaacaatcaaaaaattcaatctgaagttttagacgatattattagattaattgaatct
gccaaagatccagttattatcattgatgcttgttgtggaagacataatgctaccccagaa
gctcaaaagttgatagaattaactaaatttaaatttgccgttacaccaatggctaaagga
tcaaaagatattgatgaaagtgatccaaaatttattggttgttatgttggtgatttatca
tatccaagagttaaagagttggttgagaactcagatttggttttatctttgggtgctgtt
ttatctgactttaacactggttcattctcttattccttagataatgcaaaagtggttgaa
ttccattcagattatactcaaattaagagtgcccaatatccaggtatcagaatgaaagaa
ttattgggtaaattagtcgaagatccaaacttgatcaaaacttgttccaaaatcccagct
aagaaattggtcactgataattttgaacctttggtgttgccaccggaccataaacttact
caatcttggttatggagtaatttgggttcatggttgaaggaaggtgatgttattgttact
gaaactggtacttccaattttggtatagttcaaaccaaatttccaaaaaatgctgttgga
atttctcaagttttatggggttccattggttattcagttggttctgctgctggtgcggtt
attgctgctgaagaaattgatccaaaccgtagagttatcttatttgttggtgatggttct
ttacaattaactgtacaagaaatttccaccatggcaagacataagaataacatttatatt
tttgttttgaataataatggtttcactattgaaagattgattcatggtcctgaagctgtt
tacaatagtattcaagaatgggaaaatgcagaattattgaaaacctttaaagctacaaat
tatgaaagtttcactgtcaagacagttggtgagcttgataaggttttcaaagataaaaag
ttcgcagttaatgataaaattagattggttgaaattaaattagacactcttgatgctcca
gagaatttagttaaacaagctgaaagatctgctagtactaataaatag

DBGET integrated database retrieval system