KEGG   Candida tropicalis: CTRG_02836Help
Entry
CTRG_02836        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K00354  NADPH2 dehydrogenase [EC:1.6.99.1]
Organism
ctp  Candida tropicalis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CTRG_02836
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.1  NADPH dehydrogenase
     CTRG_02836
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_FMN
Motif
Other DBs
NCBI-GeneID: 8300339
NCBI-ProteinID: XP_002548539
UniProt: C5M8W4
Position
Unknown
AA seq 402 aa AA seqDB search
MTISKETVPITPLGNTLLFEPIKVGANTLPQRIAFAPSTRCRATADNIPTDLQLQYYDER
SKYPGTLIITEATYLSEQGGLNPHVPGIFNKRQVEGWKKINDAIHANNSFSSIQLWYLGR
VANAQHLKNKGLPYIAPSGVYWNEETEAIAEQAGNPLRALTIEEIDHIVDVEFPNAARNS
LEAGFDYVEVHSAHGYLLDQFLNTASNKRTDEYGGSIENRARLLLRIIDKLIPIVGADRL
AVRLSPWAKFQNVDTEGEEIHSYILNELQKRADEGNQLAYISLVEPRVQASWDIEEDKQV
GSNDFTYKHWKGNFIRAGTYAHELDKIDQDIDNGRTLLAFSRFFLSNPDLIEKLKDGIPL
TQYERPTFYTQDNFGYNTWPRNGESISFDEETEKARVGKPLA
NT seq 1209 nt NT seq  +upstreamnt  +downstreamnt
atgacaatctctaaagaaacagtcccaattactccattaggtaatacattactttttgaa
ccaatcaaagtaggtgccaacactttaccacaaagaattgcttttgctccttcaactcgt
tgccgtgccacagctgataatataccaacagatttacaattgcaatattatgatgaaaga
tccaaatatccaggtactttaattatcactgaagctacttatttatctgaacaaggtggt
ttaaacccacatgtaccgggtatattcaataaaagacaagttgaaggatggaagaaaatc
aacgatgctattcatgctaacaatagtttcagttctattcaattatggtatttgggacgt
gtagctaatgcacaacacttgaaaaacaaaggattaccttacattgcaccatctggagtt
tattggaatgaagaaactgaagccattgctgaacaagctggaaacccattacgtgcttta
actattgaagaaattgatcatattgttgatgttgaatttcctaacgccgcaagaaattcc
cttgaagctggttttgattatgttgaagttcactcagcacatggatacttattggatcaa
tttttgaatactgcttcaaataagagaactgatgaatatggtggtagtattgaaaaccgt
gctcgtttgttgttacgtattattgataaattgattccaattgttggagctgatagatta
gctgtcagattatcaccatgggctaaattccaaaacgttgatactgaaggtgaagaaatc
catagttatattttgaacgaattacaaaaaagagctgatgaaggaaatcaattagcttat
atttcattagttgaaccaagagttcaagcaagttgggatatcgaagaggataaacaagtt
ggatccaatgattttacttacaaacattggaaaggtaactttattagagctggtacttat
gctcatgaattagataaaattgatcaagatattgataatggaagaacattacttgctttt
tctagatttttcctttccaatcctgatttgattgaaaagttaaaggacggaattccttta
actcaatatgaaagacctactttttatactcaagacaattttggttataatacctggcca
agaaatggagaactgatctcatttgatgaagaaacagaaaaggcaagagttggaaagcca
ttagcttag

DBGET integrated database retrieval system