KEGG   Candida tropicalis: CTRG_02947Help
Entry
CTRG_02947        CDS       T01115                                 

Definition
(RefSeq) peroxiredoxin HYR1
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
ctp  Candida tropicalis
Pathway
ctp00480  Glutathione metabolism
ctp00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    CTRG_02947
  Metabolism of other amino acids
   00480 Glutathione metabolism
    CTRG_02947
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CTRG_02947
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174 SCO1-SenC
Motif
Other DBs
NCBI-GeneID: 8299396
NCBI-ProteinID: XP_002548650
UniProt: C5M975
Position
Unknown
AA seq 160 aa AA seqDB search
MSEFYKLSPKDSKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNQKYKDQDVQIL
GFPCNQFKHQEPGTNDEIVSFCSLNYGVTFPVLDKINVNGDDADAVYKYLKSQKSGFLGM
KRIKWNFEKFLIDKDGKVVARFSSLTKPESITQKIDELLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattttataaattatcaccaaaagattccaaaggtgaaccatatccatttgaa
caattaaaaggtaaagttgttttaattgttaatgttgcaagtaaatgtggtttcactcca
caatataaaggtttagaagaattgaatcaaaaatataaagatcaagatgttcaaatttta
ggtttcccatgtaatcaattcaaacatcaagaaccaggtacaaatgatgaaattgtcagt
ttttgttcattaaattatggtgttactttccctgttttagataaaatcaatgttaatggt
gatgatgctgatgcagtttataaatacttgaaatctcaaaagagtgggttcttgggaatg
aaaagaattaaatggaattttgaaaaattcttaattgataaagatggtaaagttgttgca
agattcagttctttaactaaaccagaatctatcactcaaaaaattgacgaattattgaaa
taa

DBGET integrated database retrieval system