KEGG   Candida tropicalis: CTRG_02980Help
Entry
CTRG_02980        CDS       T01115                                 

Definition
(RefSeq) peroxiredoxin HYR1
  KO
K23856  peroxiredoxin [EC:1.11.1.15]
Organism
ctp  Candida tropicalis
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CTRG_02980
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.15  peroxiredoxin
     CTRG_02980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin DUF4174
Motif
Other DBs
NCBI-GeneID: 8298465
NCBI-ProteinID: XP_002548683
UniProt: C5M9A8
Position
Unknown
AA seq 160 aa AA seqDB search
MSEFYKLAPKDSKGEPYPFEQLKGKVVLIVNVASKCGFTPQYKGLEELNQKYKDKDVQIL
GFPCNQFGHQEPGTNEEIASFCSLNYGVSFPVLDKINVNGDDTDPVYKYLKSQKSGMLGL
TRIKWNFEKFLIDKNGKVVERYSSLTSPEAIGHKIDELLK
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgtcagaattttataaattagcaccaaaagattccaaaggtgaaccatatccatttgaa
caattaaaaggtaaagttgttttaattgttaatgttgcaagtaaatgtggtttcactcca
caatataaaggtttagaagaattgaatcaaaaatataaagataaagatgttcaaatttta
ggtttcccatgtaatcaatttggacatcaagaaccaggtacaaatgaagaaattgctagt
ttttgttcattaaattatggtgttagtttcccagttttagataaaatcaatgttaatggt
gatgatactgatcctgtttataaatatttgaaatctcaaaaaagtggaatgttgggattg
actagaattaaatggaattttgaaaaattcttgattgataaaaatggtaaagttgttgaa
agatatagttctttgactagcccagaagctattggtcacaagattgatgaattattgaaa
taa

DBGET integrated database retrieval system