KEGG   Candida tropicalis: CTRG_03301
Entry
CTRG_03301        CDS       T01115                                 

Name
(RefSeq) hypothetical protein
  KO
K02988  small subunit ribosomal protein S5
Organism
ctp  Candida tropicalis
Pathway
ctp03010  Ribosome
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    CTRG_03301
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:ctp03011]
    CTRG_03301
Ribosome [BR:ctp03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Small subunit
    CTRG_03301
  Bacteria
    CTRG_03301
  Archaea
    CTRG_03301
SSDB
Motif
Pfam: Ribosomal_S5_C Ribosomal_S5
Other DBs
NCBI-GeneID: 8300256
NCBI-ProteinID: XP_002549004
UniProt: C5MB59
Position
Unknown
AA seq 331 aa
MFRQTVQPISIIKRCLSTSNKVLAEAGKKASNSKVEQHNKFLNQYYNPEILKSIQIAESV
VKPEDYMKLQLRGREAKSRVAPSQEDFDYSLKDPVWEEPIIYPNQGLGRAPYPEIPNVNS
PDRSDLRIRFKDAPVATNKQEPTAAKNPAQIAKELSELTGLDERYIRNLYVRPLIMKRVS
LKTAKGNIANFFVLSVAGDKNGMVGIGIGKSRDGIRTAATKAHWAAVKNLRAVNRYENRT
ILGSFEHKFSASKLKFSAAPIGFGLRCNRIVFEICQAAGIKDLKGKIFKARNPMHVAKGF
FEALTKQKTIEELAANRGKKIVELRKVYYSQ
NT seq 996 nt   +upstreamnt  +downstreamnt
atgttcagacaaacagtgcagcctatttccatcatcaaaagatgtttaagtacatccaat
aaagttcttgcggaagcaggtaagaaagcatcaaattccaaagttgaacaacacaataaa
tttttaaatcaatattataatccagaaatattgaaaagtattcaaattgcagaatctgtt
gttaaaccagaagattatatgaaattacaattaaggggacgtgaagccaaatctagagtt
gcaccatcacaagaagattttgattattcattaaaagatccagtatgggaagaaccaata
atatatccaaatcaagggttaggaagagctccatatccagaaattccaaatgttaattct
ccagatagaagtgatttaagaataagatttaaagatgccccagttgccaccaataagcaa
gaaccaactgccgctaaaaacccagcacaaattgctaaagaattatctgaattgacaggt
ttagatgaaagatatattagaaacttgtatgttcgtccattgatcatgaagagagtttct
ttgaaaactgccaaaggtaacattgccaatttctttgtcttgtctgttgccggtgacaag
aatggtatggttggtatcggtattggtaaatccagagatggtatcagaactgctgccact
aaagcacactgggctgctgttaaaaacttgagagcagttaacagatatgaaaatagaact
attcttggaagttttgaacataaattttctgcttctaaattgaagttttcagctgctcca
attggttttggtttaagatgtaatagaattgtttttgaaatctgtcaagctgctggtatc
aaagatttgaaaggtaaaatttttaaagccagaaacccaatgcatgttgctaaaggtttc
tttgaagctttaacaaaacaaaagacaattgaagaattagctgccaacagaggtaagaag
attgttgaattaagaaaagtttattactctcaatag

DBGET integrated database retrieval system