KEGG   Candida tropicalis: CTRG_03826Help
Entry
CTRG_03826        CDS       T01115                                 

Definition
(RefSeq) pyruvate decarboxylase
  KO
K01568  pyruvate decarboxylase [EC:4.1.1.1]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_03826
Enzymes [BR:ctp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.1  pyruvate decarboxylase
     CTRG_03826
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C
Motif
Other DBs
NCBI-GeneID: 8301452
NCBI-ProteinID: XP_002549529
UniProt: C5MDS4
Position
Unknown
AA seq 567 aa AA seqDB search
MSEITLGRFFFERLHQLQVDTVFGLPGDFNLALLDKIYEVDGMRWAGNANELNAGYAADG
YARVNPNGLAALVSTFGVGELSLTNAIAGSYSEHVGIINLVGVPSSSAQAKQLLLHHTLG
NGDFTVFHRMFKNISQTSAFISDPNTAASEIDRCIRDAYVYQRPVYIGLPSNLVDVKVPK
SLLDKKIDLSLHPNEPESQAEVVETVEKFISEASNPVILVDACAIRHNCLKEVAELIAET
QFPVFTTPMGKSSVDESNPRFGGVYVGSLSSPDVKEAVESADLVLSVGAMLSDFNTGAFS
YNYKTRNVVEFHSDYTKIRQATFPGVQMKEALQVLLKTVKKSVNPKYVPAPVPATKAITT
PGNNDPVSQEYLWRKVSDWFQEGDVIISETGTSAFGIVQSKFPKNAIGISQVLWGSIGYA
TGATCGAAMAAQEIDPKKRVILFTGDGSLQLTVQEISTMCKWDCYNTYLYVLNNDGYTIE
RLIHGEKAQYNDIQPWNNLQLLPLFNAKKYETKRISTVGELNDLFTNKEFAVPDRIRMVE
IMLPVMDAPANLVAQAKQSAATNAAQE
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaattactttgggtagattcttctttgaaagattgcaccaattgcaagttgac
accgttttcggtttaccaggtgattttaacttggctttattagataaaatctacgaagtc
gatggtatgagatgggctggtaacgccaatgaattgaacgctggttacgctgctgatggt
tacgccagagttaatccaaatggtttggctgctttagtctccaccttcggtgttggtgaa
ttgtctttgactaacgccattgctggttcttactctgaacacgttggtatcattaacttg
gttggtgttccatcttcttctgctcaagctaaacaattgttgttgcaccacaccttgggt
aacggtgatttcactgttttccacagaatgttcaagaacatttctcaaacttctgctttc
atctccgacccaaacactgctgcttctgaaattgacagatgtatcagagatgcttacgtt
taccaaagaccagtttacattggtttgccatctaacttggttgatgttaaagttccaaaa
tctttgttggacaaaaaaattgacttgtccttgcatccaaatgaaccagaatcccaagct
gaagttgttgaaaccgttgaaaaattcatttctgaagcttctaacccagttatcttggtt
gatgcttgtgctatcagacacaactgtcttaaagaagttgctgaattgattgctgaaact
caattcccagtcttcaccactccaatgggtaaatcaagtgttgatgaatccaacccaaga
ttcggtggtgtttacgttggttctttgtcttctccagatgttaaagaagccgttgaaagt
gctgacttggtcttatctgttggtgctatgttgtctgatttcaacactggtgctttctct
tacaactacaagaccagaaatgttgttgaattccactctgattacaccaagatcagacaa
gctactttcccaggtgtccaaatgaaagaagctttgcaagttttgttgaagactgtcaag
aaatctgtcaatccaaaatacgtcccagctccagttccagctaccaaagctattaccact
ccaggtaacaacgacccagtctctcaagaatacttgtggagaaaagtttctgactggttc
caagaaggtgatgttatcatttctgaaaccggtacctctgctttcggtattgtccaatct
aaattcccaaagaatgccattggtatttcccaagtcttgtggggttctattggttacgct
actggtgctacttgtggtgctgctatggctgctcaagaaattgacccaaagaagagagtt
atcttgttcactggtgatggttctttgcaattgactgtccaagaaatctctaccatgtgt
aaatgggattgttacaacacctatctttacgttttgaacaacgatggttacaccattgaa
agattgattcacggtgaaaaagctcaatataacgacattcaaccatggaacaacttgcaa
cttttgccattgttcaacgctaagaaatacgaaaccaagagaatttctactgttggtgaa
ttgaacgatttgttcactaacaaagaatttgctgttccagacagaattagaatggttgaa
attatgttgccagttatggatgctccagctaacttggttgcccaagctaaacaatctgct
gctaccaacgctgctcaagaataa

DBGET integrated database retrieval system