KEGG   Candida tropicalis: CTRG_04045Help
Entry
CTRG_04045        CDS       T01115                                 

Definition
(RefSeq) golgi apyrase
  KO
K14642  golgi apyrase [EC:3.6.1.5]
Organism
ctp  Candida tropicalis
Pathway
ctp00230  Purine metabolism
ctp00240  Pyrimidine metabolism
ctp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    CTRG_04045
   00240 Pyrimidine metabolism
    CTRG_04045
Enzymes [BR:ctp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.5  apyrase
     CTRG_04045
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GDA1_CD39
Motif
Other DBs
NCBI-GeneID: 8297023
NCBI-ProteinID: XP_002549748
UniProt: C5MCU4
Position
Unknown
AA seq 698 aa AA seqDB search
MSIVKRSTQSDDKYGIVIDSGSSGSRIQIYKWKDQKQELKSKDQAVLQSPPKIVQEKDWS
KKITPGISSFNTRSKFSKIWSDHYSDLLKFAEGIIPPEKHSETPVFVLSTAGMRLLPEKT
QKYILKETCSSIKKNTNFYIPTKDCDNFVEIIDGSTEGIYGWLGLNYLMGQFNGYDSTQD
KIHESIGFMDMGGASTQIAFVPSSKDQISKHADDLSKVTLRNINGETQTWDLFVATWLGF
GANEARKRFLNQLINLSIVQEDNWNHEISDPCLPKGALLDYTYDKKKYKIKGVGNYEMCV
KTIYPLLMKNMPCIDEPCLFNGIHGPKLNFESDKFIGISEYWYTANDIFQSGGEYNYKAF
NTKVKEFCESNWDTILSKSEQGHYSNLEPEKFLKDACFKASWVMNILHEGFELPRIGFET
DDQGETEKEKDITNVHVPFKSANSVDGGELSWTLGKILLFASSQIEPKGKKEDAREIGIF
PSEVSGKKFVPGGMIHSKDGNYYSSDDEEDDDKDSGLMHGLYSLIFILLLLFFLYHFGKS
HFGRWTNKLKKLHVPIQVRKAVNSIGSKIPGIKQYFESIVMYQDLEDQNIMLEEGVADNS
NVNLNTIPESNSASASVLRTRSAIGLNEDFGNDARGVSAQTLANSNLFNPRATNFLNKPF
VLPKKNIYNNHFSANNSRESLPRSSSNSSIPRAKSSLD
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattgttaaaaggtctacacagagtgatgacaaatatgggatagtcatagattct
ggttcatctggttcaagaattcaaatctataaatggaaggatcagaaacaagaattgaaa
tcaaaagatcaagccgtattacaatctccaccaaaaattgtacaagagaaagactggagt
aagaaaatcactcctggtatatcatcattcaatacaaggagtaagttctcaaaaatttgg
ctggaccattattccgatttgttgaagtttgctgaaggtatcattccgcctgaaaagcat
tcagaaactcccgtgtttgtcttgagtacagctggtatgagactcttacctgagaaaact
caaaaatacatacttaaagaaacttgttcaagtatcaagaagaataccaatttttatatt
cctaccaaagattgtgataactttgttgaaatcattgatgggtcaacagaaggtatttat
gggtggttagggttaaattaccttatgggtcagtttaacggatatgatagcacgcaagat
aaaattcacgagtctatcggatttatggatatgggaggtgcttcgacccagatcgcattt
gtgccgtcatccaaagaccagatttctaaacatgcagatgacttatctaaagtgacatta
agaaatataaatggggaaacgcaaacttgggatttgtttgtcgcaacttggttgggattc
ggtgccaatgaagcaagaaaacgttttcttaatcaattaatcaatttatcaattgttcag
gaagataactggaaccatgaaattagtgatccttgtttacccaagggtgctcttttagac
tacacatatgataaaaagaaatacaaaatcaaaggtgttgggaactatgaaatgtgtgtc
aagacaatttatccattgttgatgaaaaacatgccttgtatcgatgagccatgtcttttc
aatggtattcatgggccaaagttaaattttgaactggataagtttattggaatctcagaa
tattggtatactgcaaatgacattttccaaagtggtggagagtacaactataaagcgttt
aacacgaaggtcaaagaattttgtgaaagtaattgggatacaattttactgaaatcggaa
cagggacattattccaatttggagcctgaaaaattcttgaaagatgcatgttttaaagca
agttgggtgatgaatattttgcatgaagggtttgagttgccacgcattggatttgagacc
gatgaccagggtgaaactgaaaaagagaaggatatcacgaatgtacacgttccatttaaa
tcagccaactcggtagatggcggggaattatcctggacattgggtaaaattttactcttt
gcttcttcacaaattgagccaaaaggtaaaaaagaagatgctagggaaataggtatcttt
ccaagtgaagtttcaggaaagaaatttgttcctggaggtatgatccattcgaaggatggt
aactactactcaagcgatgatgaggaagacgatgacaaggatagtggtctaatgcatggt
ttatactccttgatatttattttgttgttgttatttttcttgtatcattttggaaaatca
cattttggaagatggactaacaagttgaagaaattgcatgttccaatacaagttagaaag
gctgttaattctattggatcgaagattccaggaatcaaacaatactttgagagcattgtc
atgtaccaagatcttgaagatcaaaatattatgttggaagaaggtgttgctgataattca
aatgtcaacttgaatacaattcccgaatctaattctgcatcagcatcggtattgagaact
cgtctggctattggattgaatgaagatttcggcaacgatgctagaggggtttcagcccag
acattagccaactcaaatttgtttaatccacgagctactaatttcttgaataagccgttt
gtgcttccgaaaaagaatatttataacaatcatttctcagcaaacaatagtcgagagtca
ttacctagaagctctagtaattcatctattccaagagcaaagagttcgttagattag

DBGET integrated database retrieval system