KEGG   Candida tropicalis: CTRG_04366Help
Entry
CTRG_04366        CDS       T01115                                 

Definition
(RefSeq) phosphatidylserine decarboxylase proenzyme 1, mitochondrial precursor
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
ctp  Candida tropicalis
Pathway
ctp00564  Glycerophospholipid metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
Module
ctp_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CTRG_04366
Enzymes [BR:ctp01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CTRG_04366
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PS_Dcarbxylase Big_5 HicB-like_2
Motif
Other DBs
NCBI-GeneID: 8296787
NCBI-ProteinID: XP_002550069
UniProt: C5ME74
Position
Unknown
AA seq 612 aa AA seqDB search
MKFRPPMSAWHRTSIRSNTSPFMYCPNNLSKPLSRASQMAERVNTQLEQQQQQQQQGSAN
INQRRYFSYYYYQFPKIPRPKRNMLYYSTWTSGPNVNGNGGKSNKRHLLPFGNLRISKRS
FSNANQKLKSKFKNLRMGIFSRRTNRPYIKKERRRFIKWWTITSLTVVLGGVYSKMKYER
GDHEENPYKIRPQSWHLYAYSTLPLKTISRLWGQVNSINLPVWIRSPSYRVYSAIFGVNL
DEMQNPDLKSYNNLSEFFYREIKPETRPIADGDLVSPADGKVLKFGIVQNGEIEQVKGMT
YSIDALLGLSTEKLAAPTHSLHFDHDSDDETIVRRDEEFAKINGISYSMDDIVGGNSKST
YHMNELNYEDEHDGTAAGERASFSKEMRVAEELAPNPAEYIRQKNLYFAVIYLAPGDYHH
FHSPTSWVTTLRRHFIGELFSVAPFFQKTLQGLFVLNERVALLGYWKYGFFSMIPVGATN
VGSIVVNFDKDLKTNDIYEHEIYSSATSATKVDENTPLLEERDYSASDVLTITNSEYEDK
KRKKLRKNTVYEATYTNASRLLGGYPLSKGQDVGGFKLGSTVVLIFEAPDNFKFDLEIGQ
KVKVGQSLGGFV
NT seq 1839 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcagacctcctatgtcagcttggcatagaacttctattcgactgaatactagc
ccatttatgtattgtccaaacaacttgagtaaaccattatctcgtgcatcgcaaatggca
gaaagagtcaatacacaattagaacaacaacaacaacaacaacaacaaggatcagccaat
atcaatcaaagacgttatttcagttattattattatcaatttccaaagatcccaagacca
aaacgtaacatgttatactattcaacatggacaagtggcccaaatgtaaatggaaacggt
ggtaagtcaaataagagacacttgttaccattcggtaatttgagaatttctaaaagactg
ttttctaatgccaaccagaaattaaaatccaagtttaagaacttgcgcatggggatattt
tccagacgtaccaatagaccctatatcaagaaagagcgtcgtcgttttataaaatggtgg
actatcacttctttaactgttgtgttgggtggtgtttattccaaaatgaaatatgaaaga
ggtgatcatgaagaaaatccatacaaaatcagaccacaatcgtggcatttgtatgcttat
tccacattgccattgaagacaatttccagattatggggtcaagtcaattccataaattta
ccagtttggataagaagtccatcgtatagggtgtattctgcgattttcggtgttaatttg
gacgaaatgcaaaatccggatttgaagagttataataacttgtcagaattcttctacaga
gagataaaaccagaaacacgaccaattgctgatggtgatttggtttctcctgcagatggt
aaagtcttgaagtttggtattgttcaaaatggtgaaattgaacaagttaaaggtatgacc
tactccatcgatgccttattggggttgagtactgagaaattggccgctcctacccattca
ttgcactttgatcatgatagtgatgatgaaaccattgttcgtagggacgaagaatttgcc
aaaatcaacgggatctcatattctatggatgatatcgttggaggaaactcaaaatccacc
taccatatgaacgaattgaactatgaagatgaacatgatggtactgctgctggagagaga
gcttccttctctaaggaaatgcgtgttgctgaagagcttgctccaaatccagctgaatat
atccgtcaaaagaacttatactttgctgtcatttatttagcgccaggtgattatcatcat
ttccattctccaactagctgggtcactactttgagacgtcatttcattggtgaattattt
tcagttgctccatttttccaaaagaccttacaaggtttgtttgtgttaaatgaaagagtt
gccttgttgggatattggaaatatggtttcttttctatgattccagtcggtgctaccaat
gttggtagtattgtcgttaattttgataaggatttgaaaacaaacgatatttatgaacac
gagatatattcttcggctacttctgcaacgaaagttgatgaaaatacaccattgttggaa
gaaagagactattcagccagtgatgttttgacaataactaatagtgaatatgaggataag
aaacgtaagaaattacggaaaaataccgtttatgaagcaacatatacaaatgcaagtagg
ttattaggaggatacccattgtccaaaggtcaagatgttggaggtttcaaattgggttcg
actgttgttttaatttttgaggctcccgacaactttaaatttgatttagagataggtcaa
aaggtgaaagttggtcaatcattaggtggatttgtatag

DBGET integrated database retrieval system