KEGG   Candida tropicalis: CTRG_04465Help
Entry
CTRG_04465        CDS       T01115                                 

Definition
(RefSeq) succinyl-CoA ligase alpha-chain, mitochondrial precursor
  KO
K01899  succinyl-CoA synthetase alpha subunit [EC:6.2.1.4 6.2.1.5]
Organism
ctp  Candida tropicalis
Pathway
ctp00020  Citrate cycle (TCA cycle)
ctp00640  Propanoate metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
Module
ctp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ctp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CTRG_04465
   00640 Propanoate metabolism
    CTRG_04465
Enzymes [BR:ctp01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.4  succinate---CoA ligase (GDP-forming)
     CTRG_04465
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     CTRG_04465
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ligase_CoA CoA_binding Succ_CoA_lig CoA_binding_2
Motif
Other DBs
NCBI-GeneID: 8299832
NCBI-ProteinID: XP_002550167
UniProt: C5MEH2
Position
Unknown
AA seq 323 aa AA seqDB search
MYRQFTRGFASSAPARNYASTIKNLKINSDTKVIYQGFTGKQATFHAEQAIAYGTQVVGG
INPRKAGTTHLDRPVFGTVAEAMKEAGATATGIFVPPPLAAAAIEEAITAEIPLAVAITE
GIPQKDMVRIAQILKTQDKTRLVGPNCPGVISPDQCKIGIMPSQIHQRGKVGIISRSGTL
TYEAVAQTTAVGLGQSLVIGMGGDPFPGTNFIDALTLFLNDKETEGIILIGEIGGSAEEE
ASEFLKQYNLTRPEGPKPVVSFIAGVSAPPGRRMGHAGAIVAGGKGDAKSKIAALESAGV
VVEKSPARLGKSLHAEFKNKNLL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtatagacaatttactcgtggatttgcttcttctgctccagcaagaaactatgcatca
accatcaaaaacttgaaaattaacctggatactaaagtcatctaccaaggtttcaccggt
aaacaagcaactttccatgctgaacaagcaattgcttatggtactcaagtcgttggtggt
atcaacccaagaaaagctggtactactcatttagatagaccagtttttggtactgttgct
gaagccatgaaggaagctggcgcaactgctactggtatctttgttccacctccacttgcc
gccgctgccattgaagaagctatcactgctgaaattccattggctgttgccattaccgaa
ggtatcccacaaaaagatatggttagaattgcccaaattttgaaaactcaagataaaacc
agattagttggtccaaactgtccaggtgttatctccccagatcaatgtaagatcggtatc
atgccatctcaaatccatcaaagaggtaaagttggtattatttccagatcaggtacttta
acttatgaagctgttgctcaaactactgctgttggtttgggtcaatctttggttattggt
atgggtggtgatccattcccaggtactaatttcattgatgctttgactttattcttgaac
gataaagaaaccgaaggtattattttaattggtgaaattggtggttctgctgaagaagaa
gcttctgaattcttgaaacaatacaatttgactagaccagaaggtccaaagccagttgtt
tccttcattgctggtgtctctgctcctccaggtagaagaatgggtcatgctggtgccatt
gttgccggtggtaaaggtgatgctaaatctaagattgctgctttggaatctgctggtgtt
gttgttgaaaaatccccagctagattaggtaaatctttacacgctgaattcaaaaacaaa
aacttgttatag

DBGET integrated database retrieval system