KEGG   Candida tropicalis: CTRG_04478Help
Entry
CTRG_04478        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
ctp  Candida tropicalis
Pathway
ctp00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    CTRG_04478
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     CTRG_04478
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     CTRG_04478
    1.1.1.-  
     CTRG_04478
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C
Motif
Other DBs
NCBI-GeneID: 8299847
NCBI-ProteinID: XP_002550180
UniProt: C5MEI5
Position
Unknown
AA seq 386 aa AA seqDB search
MKALVYYDKGDLRYEEDYPEPQIIQPHDVKVKIHYCGICGTDLKEYTDGPIFFPKKGEVH
EISQIFGGVIGHEISGEIVDIGKEVKDVKIGDTVVVEVTGTCKDRIRFPNSPKKPHCPSC
KDGQYNACDYLGLTGCGFTDGGCAEYMVTSSSKVIPFKGIPMDVAALIQPIAVSWHAVKV
SNFQPGESALILGGGPIGLTTIFALKGNKVGHIVVSEPALARRKLAEKLGVTTYDPTGKS
VDECVEDLKKLSPDGLGFKYSYDCSGVPATFEIGLKALKIRGCSTNVAIWAHKAIDYFPM
DVTFNEKILTGSICFVKEDFVESVRAIEDGLIPIDELKLLISSKIHLENAIEDGFVELVN
HKDKHIKILFSPKEEYRIKNDKDSHI
NT seq 1161 nt NT seq  +upstreamnt  +downstreamnt
atgaaagctttagtatattacgataaaggagatcttcgttatgaagaagactatccagaa
ccacaaataattcaaccacacgatgttaaagttaaaattcattattgtgggatatgtgga
acagatttaaaagaatatactgatggaccaatatttttccctaaaaaaggtgaagttcat
gaaatttctcaaatttttggtggggttataggtcatgaaatatctggagaaattgttgat
attggaaaagaagttaaagatgttaaaattggtgatactgttgttgttgaagttactggt
acttgtaaagatagaattagatttcctaactcacctaaaaaaccacattgtccaagttgt
aaagatggtcaatataatgcttgtgattatttaggattaactggttgtgggttcacagat
ggaggttgtgctgaatatatggttacttcatcatcaaaagtaattccatttaaaggtata
ccaatggatgttgcagcattaattcaaccaattgctgttagttggcatgctgtaaaagta
tccaattttcaacctggtgaaagtgcattaattcttggtggtggtccaattgggttgact
actatatttgcccttaaaggtaataaagtaggtcatatagttgttagtgaaccagcatta
gcaagaagaaaattggctgaaaaattaggggttacaacttatgatccaactggtaaatct
gttgatgaatgtgttgaagatcttaaaaaattatctcctgatggattaggttttaaatat
tcttatgattgttcaggagttcctgcgacttttgaaattgggttaaaagctttaaaaatt
agaggttgttctacaaatgttgcaatttgggctcataaagcaattgattatttcccaatg
gatgttacttttaatgaaaaaatattgactggttcaatttgttttgttaaagaagatttc
gttgaatcagttagagctattgaagatggtttaattccaattgatgaattaaaattattg
atttcttcaaaaattcatttagaaaatgctattgaagatggatttgttgaattggtaaat
cataaagataaacatattaaaatattattcagtccgaaagaagaatataggattaaaaat
gacaaagattctcatatttaa

DBGET integrated database retrieval system