KEGG   Candida tropicalis: CTRG_05115Help
Entry
CTRG_05115        CDS       T01115                                 

Definition
(RefSeq) 6-phosphofructokinase beta subunit
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp00030  Pentose phosphate pathway
ctp00051  Fructose and mannose metabolism
ctp00052  Galactose metabolism
ctp00680  Methane metabolism
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
ctp01200  Carbon metabolism
ctp01230  Biosynthesis of amino acids
ctp03018  RNA degradation
Module
ctp_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_05115
   00030 Pentose phosphate pathway
    CTRG_05115
   00051 Fructose and mannose metabolism
    CTRG_05115
   00052 Galactose metabolism
    CTRG_05115
  09102 Energy metabolism
   00680 Methane metabolism
    CTRG_05115
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CTRG_05115
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ctp01009]
    CTRG_05115
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:ctp03019]
    CTRG_05115
Enzymes [BR:ctp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CTRG_05115
Protein phosphatases and associated proteins [BR:ctp01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CTRG_05115
Messenger RNA biogenesis [BR:ctp03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CTRG_05115
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK SHOCT UVR
Motif
Other DBs
NCBI-GeneID: 8299271
NCBI-ProteinID: XP_002550817
UniProt: C5MGC2
Position
Unknown
AA seq 943 aa AA seqDB search
MISIVNGTSTHSLVAGTKETLSQAINFYTNILGLSVHSENDDLTYLSNEDNKMIVKIKLD
AKTGLSPSQIHDRREDIISKLNVIDWRSLDTTNVFKVENLVALIETLSTYRYTLQITPNE
LYPNEVYCVDPLGYIVGFTACAEPLTLVPPLQKANPKFDGASNLMSKSGSQSRSVEEIKQ
VRRNIGVMTSGGDSQGMNAAVRAVVRATIFRGCKAFVIKEGYEGLVKGGPEYIKETNWQD
VRGYLSEGGTNIGTARCMEFKERWGRLLGCRHLIEAGIDGLIVCGGDGSLTGADLFRHEW
PSLIAELKEKGEITAEQYERHKHLYICGMVGSIDNDMAMTDSTIGGYSALERICRAVDYI
DATASSHSRAFVVEVMGRHCGWLALMAGIATSADYILIPEKPASSKDWKDQMCDIVGKHR
AKGKRKTIVIVAEGAITSELKPITSEEVKDVLVDRLGLDTRITVLGHVQRGGTAVAYDRI
LATLQGVEAVKAILELTPDVPSPLIAIDENKICCKPLVEAVKITKSVADAIEAQDFDKAM
SLRDHEFKEHLANFMAMNSAVHEKPTLPVEKRKKIAIVNIGAPAGGMNSAVYAMATYCMS
RGHTPYAIHNGFAGLARHESVKSMNWIDIEGWNSIGGSEIGTNRQTPEDTDIGMIAHYFE
KYQFDGLIIVGGFEAFVSLEQLERSRAMYPAFRIPMVLIPATISNNVPGTEYSLGADTCL
NSLMEYCDIVKQSASATRGTAFVVDVQGGNSGYIATYAALISGAQASYVPEEGINLSQLE
NDINSLRESFCIEREMTKSGKLIIKSSNASKVLTPHVLADIINAESHGEFDTKTAIPGHV
QQGGLPSPIDRARGDRFAIKAVQFIEDHADDLSGLRYSLEFPDDDKKIMNTAAVLGVKSS
HLKFTSIRHLYDFETELGRRMPKKIHWSNTREIADRLVGRTRI
NT seq 2832 nt NT seq  +upstreamnt  +downstreamnt
atgatttcaattgttaatggtacttccacgcattcgttggttgctggaaccaaagaaaca
ttgagccaggccattaatttctacacaaatatccttgggttgtccgtacattcagaaaat
gacgacttgacatatttatcaaatgaagacaacaaaatgattgtcaaaatcaaattggac
gcaaaaactggtttgtctccatcccaaattcatgacagaagagaagatataatctccaaa
ttgaatgtcatcgattggagatcattggatactaccaatgtctttaaagttgaaaacttg
gttgccttgattgaaactttgtctacttatagatacactttacaaattaccccaaacgaa
ttgtatcctaatgaagtttactgtgttgatccattgggttatattgttggtttcacagct
tgtgccgaaccattgacccttgtgcctccattacaaaaagccaatccaaaatttgacgga
gcctccaacttgatgagcaaatctggatcccaatctagatctgttgaagaaatcaaacaa
gttagaagaaacattggtgttatgacttctggtggtgattcccaaggtatgaatgctgcc
gttagagctgttgtcagggccactatcttccgtggctgcaaagcttttgttattaaagaa
ggttatgaaggtttggttaaagggggccctgaatatatcaaagaaaccaattggcaagat
gttagagggtacctttctgaaggtggtactaacattggtactgctagatgtatggaattc
aaagaacgttggggtagattattgggttgtagacatttgattgaagccggaattgacggt
ttgattgtctgtggtggtgatggttccttaaccggggctgatcttttcagacacgaatgg
ccatcattgattgctgaattgaaagaaaagggtgaaatcactgcagaacaatacgaaaga
cacaagcacttgtacatttgtggtatggttggttctattgataatgatatggccatgaca
gattccaccattggtggttactctgctttggaaagaatctgtagagctgttgactacatt
gatgccactgccagttcccattcccgtgctttcgttgttgaagttatgggtagacattgt
ggttggttggctttgatggctggtattgccactagtgccgattatattcttatccctgaa
aaaccagcctcttctaaagactggaaagatcaaatgtgtgacattgttggtaaacacaga
gctaaaggtaagagaaagaccattgtcattgttgctgaaggtgccattacttctgaattg
aaaccaatcacctctgaagaagttaaagatgtcttggttgatagattaggtttggatacc
agaatcactgttttgggtcatgtccaaagaggtggtactgctgttgcttatgatagaatt
ttggctactttgcaaggggttgaagctgttaaagctattttggaattgaccccagatgtt
ccatccccattgattgccattgatgaaaacaagatttgctgcaaaccattggttgaagcc
gtcaagattaccaaatctgttgctgatgccattgaagctcaagatttcgacaaggccatg
tcattgagagaccatgagtttaaggaacatttagccaactttatggccatgaattctgct
gttcatgaaaaaccaactttaccagttgaaaagcgtaagaagattgctattgtcaatatt
ggtgctccagctggtggtatgaattctgcagtttatgccatggccacttattgtatgtct
agaggtcacactccatacgccatccacaatggttttgctggtttggccagacacgaatct
gttaaactgatgaattggattgatattgaaggttggaacagtattggtggttcagaaatc
ggtaccaacagacaaacacctgaagatactgatattggtatgattgcacactattttgaa
aaataccaattcgatggtttgattattgttggtggtttcgaagcatttgtttctttagaa
caattggaaagatctagagctatgtacccagctttcagaattcctatggttttgatccca
gctactatttccaataatgttccaggtactgaatactctttgggtgctgatacatgtttg
aactccttgatggaatactgtgatattgtcaaacaatctgcatctgccactagaggtact
gctttcgttgttgatgttcaaggtggtaactctggttatattgctacatatgctgctttg
atcagtggtgcccaagcctcatatgttccagaagaaggtattaacttgtctcaattagaa
aatgatatcaactcattgagagaatccttctgtattgaaagagaaatgaccaaatctggt
aaattgatcatcaagtccagtaatgcctccaaggttttgactccacatgtattggccgat
attatcaatgctgaaagtcacggtgaatttgataccaagactgctattccaggtcatgtt
caacaaggtggcttgccatctccaattgatagagccagaggtgatagatttgccattaaa
gctgttcaatttattgaagaccatgctgatgatttgagtggcttgagatactctttggaa
ttcccagatgatgataagaagattatgaacacagctgctgtattgggtgttaaatcatca
cacttgaagttcacttccatcagacacttgtatgattttgaaactgaattgggtagaaga
atgccaaagaagattcattggagtaacactagagaaattgctgatagattggttggtaga
accagaatctaa

DBGET integrated database retrieval system