KEGG   Candida tropicalis: CTRG_05375Help
Entry
CTRG_05375        CDS       T01115                                 

Definition
(RefSeq) conserved hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
ctp  Candida tropicalis
Pathway
ctp00010  Glycolysis / Gluconeogenesis
ctp01100  Metabolic pathways
ctp01110  Biosynthesis of secondary metabolites
ctp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ctp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CTRG_05375
Enzymes [BR:ctp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     CTRG_05375
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-GeneID: 8299699
NCBI-ProteinID: XP_002551077
UniProt: C5MH21
Position
Unknown
AA seq 299 aa AA seqDB search
MPVEELEDRVIITDPSDSSNSVTILKFGANIISWKNNNVEKLWLSDAAKLDGSKAVRGGI
PLVFPVFGKQKDSNHPTFKLPQHGFARNSTWEFLGQTTENPISVQFGLGPENVDPETLKL
WNFDFTLLLTITLSKDKLITTIDVENTGKESFDFNWLFHTYYRIDDITDSLVNNLAEQTC
FDQLVGESYIEKAPIISFHEEFDRIYSNVSTEKTLQIVDKGKVLFNVDRKNLPDAVVWNP
WTKKAEGMADFEPKSGFHQMLCVEPGHVATMISLPPGDKWSGAQEITLGGEIKVQAKIY
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgccagtcgaagaacttgaagatcgtgtcatcatcactgatccatctgattcatccaat
tcagtaactattttgaaatttggtgctaatattatttcatggaagaataataatgttgaa
aaattatggttatcagatgctgctaaattagatggtagtaaagccgttagaggtggtatt
ccattagttttcccagtttttggtaaacaaaaagattcaaatcatccaacttttaaatta
ccacaacatggttttgctcgtaattcaacttgggaatttttgggtcaaactactgaaaat
ccaattagtgttcaatttggtttaggtcctgaaaatgttgatccagaaactttaaaatta
tggaattttgatttcactttattattaactattactttatctaaagataaattaattaca
actattgatgttgaaaatactggtaaagaatcatttgatttcaattggttattccatact
tattatagaattgatgatattactgattctttagttaataatttggctgaacaaacttgt
tttgatcaattggttggcgaatcttatattgaaaaggctccaattattagtttccatgaa
gaatttgatagaatttattcaaatgtaagtactgaaaaaactttacaaattgttgataaa
ggtaaagttttatttaatgttgatagaaaaaatttacctgatgctgttgtttggaatcct
tggactaaaaaagctgaaggtatggctgattttgaaccaaaatccggatttcatcaaatg
ttatgtgttgaacctggtcatgtcgctacaatgatttctttacctccaggtgataaatgg
tcaggtgctcaagaaattactcttggtggtgaaattaaagttcaagctaagatttattag

DBGET integrated database retrieval system