KEGG   Candida tropicalis: CTRG_06073Help
Entry
CTRG_06073        CDS       T01115                                 

Definition
(RefSeq) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
ctp  Candida tropicalis
Pathway
ctp00450  Selenocompound metabolism
ctp00970  Aminoacyl-tRNA biosynthesis
ctp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    CTRG_06073
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CTRG_06073
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ctp01007]
    CTRG_06073
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:ctp03016]
    CTRG_06073
Enzymes [BR:ctp01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     CTRG_06073
Amino acid related enzymes [BR:ctp01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   CTRG_06073
Transfer RNA biogenesis [BR:ctp03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    CTRG_06073
 Prokaryotic type
   Other AARSs
    CTRG_06073
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g MetRS-N tRNA-synt_1 Anticodon_1 tRNA-synt_1e EKLF_TAD1
Motif
Other DBs
NCBI-GeneID: 8298722
NCBI-ProteinID: XP_002546595
UniProt: C5MJ30
Position
Unknown
AA seq 748 aa AA seqDB search
MSLEVYGTKGSSLLALSNNLKLAIALSSYQPKLSLTLNETESQLSLKDKKSGFELIEPNA
IVKYLANDFTNDKAIKFEEQVVYPVLKSNKSDGILKISDLPSFEKAEITPAQIILFSSLY
PALKSSTENKWFVEFSKIPEVATGIKNALAITPVERTKETNTGKQNVQTGHLIKKQADKI
LPKSDERNILITSALPYVNNVPHLGNIVGSVLSADIYSRYAKNRNYNALFVCGTDEYGTA
TETKALEEKVTPQQLCDKYHAIHKEVYDWFDIGFDYFGRTTTPLQTEIAQDIFMKLHKNG
YLEEKTTEQLYCEEHKSFLADRFVEGTCPKCEYDDARGDQCDKCGNLLDPLELIKPRCKL
DGASPIVKESTHIYLKLNELEEPLKEWIIDSSAKGAWSKNSKSITDSWTKRGLEPRCITR
DLIWGTPVPLKGYEEKVLYVWFDATIGYISITANYFKDGNVDDYLKWWKNPENVDLYQFM
GKDNVPFHTVVFPASQIGTGDNWTKLHHLSTTEYLQYENGKFSKSRGVGVFGNNAKETGV
SPSVWRYYLASNRPENQDSHFSWDEFVAKNNNELLANLGNYVNRIVKFLIAKYNGVVPKY
DVSNIPDYASFEKDINTLLSSYIENMESVNLRKGLELAMAISSRGNQFLQDNKLDNSLYT
NQPNKSDAVVAVAINLVYLISAIIYPFMPETTKQINEILNAPSLSITDKFEFVLLPGHCI
GKAQYLFTRIDEKKIEEWRGLYGGQQQK
NT seq 2247 nt NT seq  +upstreamnt  +downstreamnt
atgtccttagaagtttatggaactaaaggtagttcattattagcattgtccaataatttg
aaattggccattgcattatcttcataccaaccaaaactttccctcactttaaatgaaact
gaatcccaattgtctttaaaagataagaaatccggatttgaattaattgaaccaaatgct
attgttaaatatttagctaatgatttcactaatgataaagcaattaaatttgaagaacaa
gttgtctatccagttcttaaatcaaataaatctgatggaattttgaaaatttctgactta
ccaagttttgaaaaagctgaaattactcctgctcaaattattttattttcaagtttatat
ccagctttgaaatcttctactgaaaataaatggtttgttgaattcagtaagattccagaa
gttgcaactggtattaagaatgcattagcaatcactccagttgaaagaactaaagaaaca
aacactggtaaacaaaatgttcaaactggtcatttgattaaaaaacaagctgataaaatt
cttccaaagtctgatgaaagaaacattttaatcacttctgctttaccttatgttaataat
gttccacatttaggtaatattgttggatcagttttatccgccgatatctatagtcgttat
gctaagaatagaaactacaatgctttgtttgtttgtggtactgatgaatacggtactgct
actgaaactaaagcattggaagaaaaagttactcctcaacaattgtgtgataaatatcat
gctattcacaaggaagtttatgattggtttgatattggatttgattattttggtagaact
acaactccattacaaacagaaattgctcaagatattttcatgaaattacataaaaatgga
tatttggaagaaaaaaccactgagcaattatactgtgaagaacacaagtcatttttagct
gatagatttgttgaaggtacttgtccaaaatgtgaatatgatgatgctagaggtgatcaa
tgtgataaatgtggtaacttgttggatcctttagaattgattaaaccacgttgtaaactt
gatggtgctagtccaattgttaaagaatccactcatatttatcttaaattgaatgaatta
gaagaaccattaaaagaatggattatcgactcttctgctaaaggtgcttggtccaagaat
tcaaagagtattaccgattcatggaccaagagaggtttggaaccaagatgtattactaga
gatttgatctggggtactccagttccattaaagggatatgaagaaaaggtcttgtatgtt
tggtttgatgctactattggttatatttccattacagccaattatttcaaagatggaaat
gttgacgattatcttaaatggtggaaaaacccagaaaatgttgatttgtatcaatttatg
ggtaaggataatgttccattccatactgttgtcttcccagcttcacaaattggtactggt
gataattggactaaattgcatcatttaagtactactgaatatttacaatacgaaaatggt
aaattcagtaagagtagaggtgttggtgtctttggtaacaatgctaaagaaactggtgtt
tcaccatctgtttggagatactatttggcttctaacagaccagaaaatcaagattctcat
ttctcatgggatgaatttgttgcgaaaaacaataatgaattgttggccaacttgggtaat
tatgttaacagaattgttaaattcttgattgccaaatataatggagtggttccaaaatat
gatgtttccaacattccagattacgcatcatttgaaaaggatattaacactttgttgtca
agttatattgaaaacatggaaagtgtcaatttaagaaaaggtttagaacttgccatggct
atttcttccagaggtaaccaattcttacaagataataaattagataacagtttatacact
aatcaaccaaacaaatccgatgctgttgtagctgttgctattaatttggtttatttgatt
agtgctatcatttatccatttatgccagaaacaaccaaacaaattaatgaaattttgaat
gcaccaagtttgtcaatcactgataaatttgaatttgtcttgttgccaggtcattgtatt
ggtaaagctcaatacttgtttaccagaattgatgaaaagaagattgaagaatggagaggt
ttatatggtggacaacaacaaaagtga

DBGET integrated database retrieval system