KEGG   Candida tropicalis: CTRG_06074Help
Entry
CTRG_06074        CDS       T01115                                 

Definition
(RefSeq) hypothetical protein
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
ctp  Candida tropicalis
Pathway
ctp00970  Aminoacyl-tRNA biosynthesis
ctp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CTRG_06074
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ctp03029]
    CTRG_06074
Enzymes [BR:ctp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CTRG_06074
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CTRG_06074
Mitochondrial biogenesis [BR:ctp03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CTRG_06074
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-GeneID: 8298723
NCBI-ProteinID: XP_002546596
UniProt: C5MJ31
Position
Unknown
AA seq 459 aa AA seqDB search
MIKLLPATKRSIRCLTTTSSTHELLDKWNCLISTVTIEPTSTGPLSGTKYILKDNIVTKN
STSTAASKTLSNYKSPFNATIVDLLSSQGSTLVGKSNLDEFGMGSANLNSYFGPVINPQD
KPKITGGSSGGSAAAVSSGICDFSIGTDTGGSVRLPASYCQVFGFKPTYGRISRWGVIPY
AQTLDTVGILGNNIDIIHEVYNVLNKYDEKDPTSLPEEVRNKIDATINTEKLVIGIPEEF
ILDELSDAVRNSWKEILVRLQEQGHEIKPISIGSIKKSLPAYYTLATAEAASNLSRYDGI
RYGDNSQNQVETASDLIFSNRSTNFGPEVQRRIILGNYTLSSDSGDHYLRATEIRRELCI
EFSTSFKKSHILLQDGETSTGVDLIIAPTATKSAPNVDEFVSENEENFLNGYVNDVLTVP
ASLTGIPTISIPFNGIGIQLMGQFGDDELVLQVAKDLSN
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgattaaactactaccagccactaaaagatcaattagatgtttgacaacaacttcatca
actcatgaattactagataaatggaattgtctaatatcgactgtgaccattgaaccaaca
tctactggaccattatctggcacgaaatatattctaaaagataatatagttactaaaaac
agtacctccaccgctgcatcaaagaccttatctaattataaatctcccttcaatgccact
attgttgacttactctcatctcaaggatcaacacttgttggtaaatcaaacttggatgaa
tttggaatgggttcagcaaatttgaattcttattttggacccgtgattaatccacaagat
aaacctaaaattactggtggttcttctggaggtagtgctgctgctgtatctagtggaata
tgcgatttttcaattggtacagatactggaggttctgtaagattacctgcttcttattgt
caggtttttggtttcaaaccaacctacggtaggatttctcgttggggtgttattccgtat
gctcaaactttggatactgtggggattttgggaaataatattgatatcatccatgaagtt
tataatgttcttaataagtatgatgaaaaagatcctacatcattacccgaagaggtcaga
aacaagattgatgcgactataaacactgaaaaacttgttattggtatcccggaagaattc
attcttgatgagttatctgatgctgtgagaaattcatggaaggaaattttagtcaggtta
caagaacaaggtcatgaaatcaagcctatatctattggcagtattaaaaaatcattaccg
gcatactacaccctagcaactgccgaagccgcttccaatctttcaagatatgatggaata
cgatatggtgataattcacaaaatcaagttgaaactgcttctgatttgatattcagtaat
agatcaacaaatttcggtcctgaagtacaacgaagaattattcttggtaattatacatta
tcttcagattcaggggatcattatcttcgagcaactgaaattcgtcgagaattatgtatt
gaattttccacatcatttaaaaaatctcatattttacttcaagatggtgaaacatcaact
ggggttgatttaataattgctccaacagccactaaatcagcaccgaatgtcgatgaattt
gtatctgaaaacgaagaaaatttcttgaatggatatgttaatgacgtattaactgttcca
gcatcattgactggtatacctactatatctatcccattcaatggaatcggtattcaatta
atgggtcagtttggtgacgatgaattggtcttacaagttgccaaagatttatcaaattaa

DBGET integrated database retrieval system