KEGG   Candida tropicalis: CTRG_06088Help
Entry
CTRG_06088        CDS       T01115                                 

Definition
(RefSeq) delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial precursor
  KO
K00294  1-pyrroline-5-carboxylate dehydrogenase [EC:1.2.1.88]
Organism
ctp  Candida tropicalis
Pathway
ctp00250  Alanine, aspartate and glutamate metabolism
ctp00330  Arginine and proline metabolism
ctp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ctp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CTRG_06088
   00330 Arginine and proline metabolism
    CTRG_06088
Enzymes [BR:ctp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CTRG_06088
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh OmdA
Motif
Other DBs
NCBI-GeneID: 8298737
NCBI-ProteinID: XP_002546610
UniProt: C5MJ45
Position
Unknown
AA seq 588 aa AA seqDB search
MLRTSARNTVRLATKFAKVSPIILRATPVRTTTIRFASQLAHVKTPPNLQNEPVKNFGFK
DTKDWDLLRASITKFTDEGALKVPLVVGGKKIYREETKPQVNPAKHSQILADVSQAVPED
IKAAIESAKAAKAKWAATPWSDRAAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEID
CVAELIDFFKFNVKYAEELYQQQPLQTSPGVWNRAEYRPLEGFVYAVTPFNFTAIAANLV
GAPALMGNTVVWKPSATAALSNYLLLTILEEAGLPAGVINFIPGDPVEVTDIVLNDREFS
ALHFTGSTDVFKKLYSQISTNVAQDKYRDFPRIVGETGGKNFHLIHPSAAINHSALSTLR
GAFEYQGQKCSATSRAYVPESIWPDFKDQLVGAVSQISIGNTSSVENLNSFMGPVIHEES
FNKLANAIEKAKQDPELEIIIGGEHDKTNGFYVQPTVIKTTNPNHEYLSKEFFGPILTIY
VYPDGEYEQIIESIDTVTKYGLTGSVFARDREAIRKAEENLRYSAGNFYINDKSTGAVVG
QQWFGGARGSGTNDKAGSGNILSRFVSVRNVKENFYELSDFKYPSNYQ
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atgttaagaacatctgctcgcaacactgtacgcttagctactaaattcgctaaagtttcc
ccaattattcttcgtgccacccctgtgagaaccaccaccattaggtttgcatctcaatta
gctcatgttaaaactccaccaaatttacaaaatgaaccggttaagaatttcgggtttaaa
gatactaaagattgggatttattaagagcttcaattactaaattcactgatgaaggggca
ttgaaggttccattagttgttggaggtaagaaaatttaccgtgaagaaaccaaaccacaa
gtaaatccagctaaacattcacaaattttagctgatgtttcacaagccgtacctgaagat
attaaagctgctattgaatcagctaaagcagcaaaagccaaatgggctgctactccatgg
agcgacagagcagctattttcttgaaagctgctgatttaatttctactaaatatagatat
gatatgttggcagcaactatgttgggacaaggtaagaatgtataccaagctgaaattgat
tgtgttgctgaattgattgattttttcaaatttaatgttaaatatgcagaagaattgtat
cagcaacaaccattgcaaacttcaccaggtgtttggaatcgtgctgaatatagaccatta
gaagggtttgtttatgctgttaccccattcaatttcactgccattgctgccaatttagtt
ggtgctcctgccttaatgggtaatactgttgtttggaaaccttctgctaccgcagcatta
tcaaattatttattattaacaattttggaggaagctggcttacctgcaggtgttattaat
ttcattcctggtgatccagttgaagtcactgatattgttttaaatgatagggaattttct
gcattgcatttcaccggttccactgatgttttcaaaaaattgtattcacaaattagtact
aatgttgcacaagataaataccgtgatttcccaagaattgttggtgaaactggtggtaag
aatttccatttaattcatccaagtgctgctattaaccattctgcattatccacattaaga
ggtgcttttgaatatcaaggtcaaaaatgttctgctacttcacgagcatatgttccagaa
tctatctggccagatttcaaagatcaattggttggagcagtttcacaaattagtatcgga
aatacatcaagtgttgaaaacttgaattcatttatgggaccagttattcatgaagaaagt
tttaataaattagccaatgctattgaaaaggctaaacaagatccagaattagaaattatt
attggtggggaacacgacaaaacaaatggattttatgttcaaccaactgtaatcaaaacc
accaatccaaatcatgaatatttatcaaaagaattttttggtccaattttaacaatttat
gtatatccagacggtgaatatgaacaaattatagaaagtattgatactgttactaaatat
ggattaacaggatctgtatttgcaagagatagagaagctattagaaaagctgaagaaaat
ttaagatattctgcaggtaatttctatattaatgataaatcaaccggtgctgttgttggt
caacaatggtttggtggtgccagaggatctggtactaatgacaaagcaggtagtggtaat
attttatcaaggtttgtgtctgttagaaatgttaaagaaaatttctacgaattgtcagat
tttaaatacccatcaaactatcaatag

DBGET integrated database retrieval system