KEGG   Chlamydia trachomatis G/11222: G11222_01100Help
Entry
G11222_01100      CDS       T01905                                 

Definition
(GenBank) fructose-bisphosphate aldolase
  KO
K11645  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
ctq  Chlamydia trachomatis G/11222
Pathway
ctq00010  Glycolysis / Gluconeogenesis
ctq00030  Pentose phosphate pathway
ctq00051  Fructose and mannose metabolism
ctq00680  Methane metabolism
ctq01100  Metabolic pathways
ctq01110  Biosynthesis of secondary metabolites
ctq01120  Microbial metabolism in diverse environments
ctq01130  Biosynthesis of antibiotics
ctq01200  Carbon metabolism
ctq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ctq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    G11222_01100
   00030 Pentose phosphate pathway
    G11222_01100
   00051 Fructose and mannose metabolism
    G11222_01100
  Energy metabolism
   00680 Methane metabolism
    G11222_01100
Enzymes [BR:ctq01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     G11222_01100
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DeoC Biotin_carb_N
Motif
Other DBs
NCBI-ProteinID: ADH18824
Position
243648..244694
Genome map
AA seq 348 aa AA seqDB search
MTTIFDLLGKDADYLLNHKCVIKKEALTLPSGDLVSRVFAESDRNNRVLRSLQQMFSCGR
LGGTGYLSILPVDQGVEHTAGASFAKNPMYFDPENIVRLAMEAGCSAVASSYGVLSILAR
RYAHKIPFLLKLNHNELLSYPTTYHQIFFSQVEDAYNMGAVAVGATIYFGSESSSEEIVA
VAEAFARARELGLATVLWCYLRNPHFVVNNVDYHTAADLTGQADHLGATLGADIVKQKLP
TLQGGFKTINFSKTDDLVYSELSSNHPIDLCRYQVLNSYCGKVGLINSGGPSGQDDFAEA
VKTAVINKRAGGMGLILGRKAFQRPFSEGVRLLNLIQDIYLDPTISIS
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgatttttgatcttcttggtaaagacgccgactatctccttaaccacaagtgt
gttataaaaaaagaagctttaacgcttccttctggagacctcgtatcacgagtttttgca
gaatcagacagaaataatcgggtgctccgttcccttcaacagatgttcagttgtggacgc
ttaggcggaacaggatacctctctattctccctgttgaccaaggtgtcgaacatactgca
ggcgcatcgtttgccaagaatcctatgtactttgatccagaaaatatcgtgcgtctggct
atggaagctggctgttccgcggtagcttcttcctatggcgtgttaagtatattggctaga
cgatatgctcataaaattccttttttacttaaactaaaccacaacgaactgctatcctac
ccgacaacatatcaccaaatcttcttcagtcaagttgaagatgcctataatatgggagct
gttgctgtcggagcaacgatttactttggatcagagtcttcttctgaagaaattgttgct
gttgccgaagcttttgcaagagctagagagcttggcttggctacagtgttatggtgctat
ttaaggaatccacattttgttgtgaataatgtggattaccacactgctgccgatttaaca
gggcaagcggaccatcttggagcaactttaggagctgatatcgttaagcaaaagctccca
actcttcaaggaggatttaaaacaattaatttcagcaagactgatgatcttgtgtactcg
gagctttcatcaaaccaccctattgacctctgtcggtaccaggtacttaatagttactgt
ggaaaggttggtctaattaactccggaggcccttctgggcaagatgactttgctgaagca
gttaaaacagcagtaattaataaacgagctggtggcatgggactgattttagggagaaaa
gctttccagagacccttctctgaaggcgtccggttactcaatttaattcaagatatttat
ttagatccgacaatctccatatcataa

DBGET integrated database retrieval system