KEGG   Chlamydia trachomatis D/UW-3/CX: CT_265Help
Entry
CT_265            CDS       T00017                                 

Gene name
accA
Definition
(RefSeq) acetyl-CoA carboxylase carboxyltransferase subunit alpha
  KO
K01962  acetyl-CoA carboxylase carboxyl transferase subunit alpha [EC:6.4.1.2 2.1.3.15]
Organism
ctr  Chlamydia trachomatis D/UW-3/CX
Pathway
ctr00061  Fatty acid biosynthesis
ctr00620  Pyruvate metabolism
ctr00640  Propanoate metabolism
ctr01100  Metabolic pathways
ctr01110  Biosynthesis of secondary metabolites
ctr01120  Microbial metabolism in diverse environments
ctr01130  Biosynthesis of antibiotics
ctr01200  Carbon metabolism
ctr01212  Fatty acid metabolism
Module
ctr_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:ctr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    CT_265 (accA)
   00640 Propanoate metabolism
    CT_265 (accA)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    CT_265 (accA)
Enzymes [BR:ctr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.15  acetyl-CoA carboxytransferase
     CT_265 (accA)
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     CT_265 (accA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACCA Carboxyl_trans Trimer_CC
Motif
Other DBs
NCBI-GeneID: 884858
NCBI-ProteinID: NP_219770
UniProt: O84267
Position
complement(296405..297379)
Genome map
AA seq 324 aa AA seqDB search
MELLPHEKQVVEYEKTIAEFKEKNKENSLLSSSEIQKLDKRLDRLKEKIYSDLTPWERVQ
ICRHPSRPRTVNYIEGMCEEFVELCGDRTFRDDPAVVGGFAKIQGQRFMLIGQEKGCDTK
SRMHRNFGMLCPEGFRKALRLAKMAEKFGLPIIFLVDTPGAFPGLTAEERGQGWAIATNL
FELARLATPIIVIVIGEGCSGGALGMAIGDVVAMLEHSYYSVISPEGCASILWKDPKKNS
DAAAMLKMHGEDLKGFAIVDAVIKEPIGGAHHNPAATYRSVQEYVLQEWLKLKDLPVEEL
LEKRYQKFRTIGLYETSSESDSEA
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtggaactacttcctcatgaaaaacaggttgtcgaatacgaaaaaacgatcgccgagttt
aaagaaaaaaataaagaaaacagcctgctttcttcttcagagattcaaaaattggataag
cgtttagatagattaaaagaaaaaatttattccgatctcaccccttgggaaagagtacaa
atttgtcgacatccttcgagacctagaacagtgaattatatcgaaggaatgtgcgaagag
tttgtagaactttgtggagatcgaacgttccgagatgatcctgcagttgtcggagggttc
gcaaagattcaagggcagcgtttcatgcttatagggcaagaaaagggttgcgacacaaaa
tctcgcatgcatcgtaacttcgggatgctttgtcccgaaggctttagaaaggctctacgc
ttagctaaaatggcagagaaattcggtttgccaattatctttctcgttgatacccctgga
gctttccctggattaacagccgaagaaagaggtcaaggttgggctattgcgacaaactta
tttgagttagctagattagctaccccaatcattgtaattgtgattggtgaaggatgttca
ggaggcgctctaggaatggctataggagatgttgtagcgatgctagaacactcgtattat
tctgtaatttctcctgaagggtgtgcttctattttatggaaagatcctaaaaagaacagc
gatgctgctgccatgttaaaaatgcatggagaggatcttaagggatttgctattgtggac
gcagtgatcaaagaacccataggtggggctcatcacaatcctgcggccacatatcgtagt
gttcaagaatatgtccttcaagaatggcttaaattgaaagatttaccggtagaagagttg
ctagaaaaacgatatcagaaattccgaacgataggtctatatgaaacttcttctgaaagc
gattctgaggcataa

DBGET integrated database retrieval system